ASAH3 (ACER1) (NM_133492) Human Tagged ORF Clone

SKU
RC211332
ACER1 (Myc-DDK-tagged)-Human alkaline ceramidase 1 (ACER1)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol ASAH3
Synonyms ALKCDase1; ASAH3
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC211332 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCCTAGCATCTTCGCCTATCAGAGCTCCGAGGTGGACTGGTGTGAGAGCAACTTCCAGTACTCGGAGC
TGGTGGCCGAGTTCTACAACACGTTCTCCAATATCCCCTTCTTCATCTTCGGGCCACTGATGATGCTCCT
GATGCACCCGTATGCCCAGAAGCGCTCCCGCTACATTTACGTTGTCTGGGTCCTCTTCATGATCATAGGC
CTGTTCTCCATGTATTTCCACATGACGCTCAGCTTCCTGGGCCAGCTGCTGGACGAGATCGCCATCCTGT
GGCTCCTGGGCAGTGGCTATAGCATATGGATGCCCCGCTGCTATTTCCCCTCCTTCCTTGGGGGGAACAG
GTCCCAGTTCATCCGCCTGGTCTTCATCACCACTGTGGTCAGCACCCTTCTGTCCTTCCTGCGGCCCACG
GTCAACGCCTACGCCCTCAACAGCATTGCCCTGCACATTCTCTACATCGTGTGCCAGGAGTACAGGAAGA
CCAGCAATAAGGAGCTTCGGCACCTGATTGAGGTCTCCGTGGTTTTATGGGCTGTTGCTCTGACCAGCTG
GATCAGTGACCGTCTGCTTTGCAGCTTCTGGCAGAGGATTCATTTCTTCTATCTGCACAGCATCTGGCAT
GTGCTCATCAGCATCACCTTCCCTTATGGCATGGTCACCATGGCCTTGGTGGATGCCAACTATGAGATGC
CAGGTGAAACCCTCAAAGTCCGCTACTGGCCTCGGGACAGTTGGCCCGTGGGGCTGCCCTACGTGGAAAT
CCGGGGTGATGACAAGGACTGC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC211332 protein sequence
Red=Cloning site Green=Tags(s)

MPSIFAYQSSEVDWCESNFQYSELVAEFYNTFSNIPFFIFGPLMMLLMHPYAQKRSRYIYVVWVLFMIIG
LFSMYFHMTLSFLGQLLDEIAILWLLGSGYSIWMPRCYFPSFLGGNRSQFIRLVFITTVVSTLLSFLRPT
VNAYALNSIALHILYIVCQEYRKTSNKELRHLIEVSVVLWAVALTSWISDRLLCSFWQRIHFFYLHSIWH
VLISITFPYGMVTMALVDANYEMPGETLKVRYWPRDSWPVGLPYVEIRGDDKDC

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_133492
ORF Size 792 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_133492.3
RefSeq Size 1088 bp
RefSeq ORF 795 bp
Locus ID 125981
UniProt ID Q8TDN7
Cytogenetics 19p13.3
Protein Families Transmembrane
Protein Pathways Metabolic pathways, Sphingolipid metabolism
MW 31.1 kDa
Summary Ceramides are synthesized during epidermal differentiation and accumulate within the interstices of the stratum corneum, where they represent critical components of the epidermal permeability barrier. Excess cellular ceramide can trigger antimitogenic signals and induce apoptosis, and the ceramide metabolites sphingosine and sphingosine-1-phosphate (S1P) are important bioregulatory molecules. Ceramide hydrolysis in the nucleated cell layers regulates keratinocyte proliferation and apoptosis in response to external stress. Ceramide hydrolysis also occurs at the stratum corneum, releasing free sphingoid base that functions as an endogenous antimicrobial agent. ACER1 is highly expressed in epidermis and catalyzes the hydrolysis of very long chain ceramides to generate sphingosine (Houben et al., 2006 [PubMed 16477081]; Sun et al., 2008 [PubMed 17713573]).[supplied by OMIM, Jul 2010]
Write Your Own Review
You're reviewing:ASAH3 (ACER1) (NM_133492) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC211332L1 Lenti ORF clone of Human alkaline ceramidase 1 (ACER1), Myc-DDK-tagged 10 ug
$600.00
RC211332L2 Lenti ORF clone of Human alkaline ceramidase 1 (ACER1), mGFP tagged 10 ug
$600.00
RC211332L3 Lenti ORF clone of Human alkaline ceramidase 1 (ACER1), Myc-DDK-tagged 10 ug
$600.00
RC211332L4 Lenti ORF clone of Human alkaline ceramidase 1 (ACER1), mGFP tagged 10 ug
$600.00
RG211332 ACER1 (tGFP-tagged) - Human alkaline ceramidase 1 (ACER1) 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC305969 ACER1 (untagged)-Human alkaline ceramidase 1 (ACER1) 10 ug
$330.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.