Casein Kinase 2 beta (CSNK2B) (NM_001320) Human Tagged ORF Clone

SKU
RC211299
CSNK2B (Myc-DDK-tagged)-Human casein kinase 2, beta polypeptide (CSNK2B)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol Casein Kinase 2 beta
Synonyms CK2B; CK2N; Ckb1; Ckb2; CSK2B; G5A; POBINDS
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC211299 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAGCAGCTCAGAGGAGGTGTCCTGGATTTCCTGGTTCTGTGGGCTCCGTGGCAATGAATTCTTCTGTG
AAGTGGATGAAGACTACATCCAGGACAAATTTAATCTTACTGGACTCAATGAGCAGGTCCCTCACTATCG
ACAAGCTCTAGACATGATCTTGGACCTGGAGCCTGATGAAGAACTGGAAGACAACCCCAACCAGAGTGAC
CTGATTGAGCAGGCAGCCGAGATGCTTTATGGATTGATCCACGCCCGCTACATCCTTACCAACCGTGGCA
TCGCCCAGATGTTGGAAAAGTACCAGCAAGGAGACTTTGGTTACTGTCCTCGTGTGTACTGTGAGAACCA
GCCAATGCTTCCCATTGGCCTTTCAGACATCCCAGGTGAAGCCATGGTGAAGCTCTACTGCCCCAAGTGC
ATGGATGTGTACACACCCAAGTCATCAAGACACCATCACACGGATGGCGCCTACTTCGGCACTGGTTTCC
CTCACATGCTCTTCATGGTGCATCCCGAGTACCGGCCCAAGAGACCTGCCAACCAGTTTGTGCCCAGGCT
CTACGGTTTCAAGATCCATCCGATGGCCTACCAGCTGCAGCTCCAAGCCGCCAGCAACTTCAAGAGCCCA
GTCAAGACGATTCGC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC211299 protein sequence
Red=Cloning site Green=Tags(s)

MSSSEEVSWISWFCGLRGNEFFCEVDEDYIQDKFNLTGLNEQVPHYRQALDMILDLEPDEELEDNPNQSD
LIEQAAEMLYGLIHARYILTNRGIAQMLEKYQQGDFGYCPRVYCENQPMLPIGLSDIPGEAMVKLYCPKC
MDVYTPKSSRHHHTDGAYFGTGFPHMLFMVHPEYRPKRPANQFVPRLYGFKIHPMAYQLQLQAASNFKSP
VKTIR

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_001320
ORF Size 645 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_001320.7
RefSeq Size 1149 bp
RefSeq ORF 648 bp
Locus ID 1460
UniProt ID P67870
Cytogenetics 6p21.33
Domains CK_II_beta
Protein Families Druggable Genome
Protein Pathways Adherens junction, Tight junction, Wnt signaling pathway
MW 24.9 kDa
Summary This gene encodes the beta subunit of casein kinase II, a ubiquitous protein kinase which regulates metabolic pathways, signal transduction, transcription, translation, and replication. The enzyme is composed of three subunits, alpha, alpha prime and beta, which form a tetrameric holoenzyme. The alpha and alpha prime subunits are catalytic, while the beta subunit serves regulatory functions. The enzyme localizes to the endoplasmic reticulum and the Golgi apparatus. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Sep 2013]
Write Your Own Review
You're reviewing:Casein Kinase 2 beta (CSNK2B) (NM_001320) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC211299L1 Lenti ORF clone of Human casein kinase 2, beta polypeptide (CSNK2B), Myc-DDK-tagged 10 ug
$600.00
RC211299L2 Lenti ORF clone of Human casein kinase 2, beta polypeptide (CSNK2B), mGFP tagged 10 ug
$600.00
RC211299L3 Lenti ORF clone of Human casein kinase 2, beta polypeptide (CSNK2B), Myc-DDK-tagged 10 ug
$600.00
RC211299L4 Lenti ORF clone of Human casein kinase 2, beta polypeptide (CSNK2B), mGFP tagged 10 ug
$600.00
RG211299 CSNK2B (tGFP-tagged) - Human casein kinase 2, beta polypeptide (CSNK2B) 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC108248 CSNK2B (untagged)-Human casein kinase 2, beta polypeptide (CSNK2B) 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.