CEBPD (NM_005195) Human Tagged ORF Clone

SKU
RC211266
CEBPD (Myc-DDK-tagged)-Human CCAAT/enhancer binding protein (C/EBP), delta (CEBPD)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol CEBPD
Synonyms C/EBP-delta; CELF; CRP3; NF-IL6-beta
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC211266 representing NM_005195
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAGCGCCGCGCTCTTCAGCCTGGACGGCCCGGCGCGCGGCGCGCCCTGGCCTGCGGAGCCTGCGCCCT
TCTACGAACCGGGCCGGGCGGGCAAGCCGGGCCGCGGGGCCGAGCCAGGGGCCCTAGGCGAGCCAGGCGC
CGCCGCCCCCGCCATGTACGACGACGAGAGCGCCATCGACTTCAGCGCCTACATCGACTCCATGGCCGCC
GTGCCCACCCTGGAGCTGTGCCACGACGAGCTCTTCGCCGACCTCTTCAACAGCAATCACAAGGCGGGCG
GCGCGGGGCCCCTGGAGCTTCTTCCCGGCGGCCCCGCGCGCCCCTTGGGCCCGGGCCCTGCCGCTCCCCG
CCTGCTCAAGCGCGAGCCCGACTGGGGCGACGGCGACGCGCCCGGCTCGCTGTTGCCCGCGCAGGTGGCC
GCGTGCGCACAGACCGTGGTGAGCTTGGCGGCCGCAGGGCAGCCCACCCCGCCCACGTCGCCGGAGCCGC
CGCGCAGCAGCCCCAGGCAGACCCCCGCGCCCGGCCCCGCCCGGGAGAAGAGCGCCGGCAAGAGGGGCCC
GGACCGCGGCAGCCCCGAGTACCGGCAGCGGCGCGAGCGCAACAACATCGCCGTGCGCAAGAGCCGCGAC
AAGGCCAAGCGGCGCAACCAGGAGATGCAGCAGAAGTTGGTGGAGCTGTCGGCTGAGAACGAGAAGCTGC
ACCAGCGCGTGGAGCAGCTCACGCGGGACCTGGCCGGCCTCCGGCAGTTCTTCAAGCAGCTGCCCAGCCC
GCCCTTCCTGCCGGCCGCCGGGACAGCAGACTGCCGG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC211266 representing NM_005195
Red=Cloning site Green=Tags(s)

MSAALFSLDGPARGAPWPAEPAPFYEPGRAGKPGRGAEPGALGEPGAAAPAMYDDESAIDFSAYIDSMAA
VPTLELCHDELFADLFNSNHKAGGAGPLELLPGGPARPLGPGPAAPRLLKREPDWGDGDAPGSLLPAQVA
ACAQTVVSLAAAGQPTPPTSPEPPRSSPRQTPAPGPAREKSAGKRGPDRGSPEYRQRRERNNIAVRKSRD
KAKRRNQEMQQKLVELSAENEKLHQRVEQLTRDLAGLRQFFKQLPSPPFLPAAGTADCR

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_005195
ORF Size 807 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_005195.4
RefSeq Size 1295 bp
RefSeq ORF 810 bp
Locus ID 1052
UniProt ID P49716
Cytogenetics 8q11.21
Domains BRLZ
Protein Families Druggable Genome, Transcription Factors
MW 28.3 kDa
Summary The protein encoded by this intronless gene is a bZIP transcription factor which can bind as a homodimer to certain DNA regulatory regions. It can also form heterodimers with the related protein CEBP-alpha. The encoded protein is important in the regulation of genes involved in immune and inflammatory responses, and may be involved in the regulation of genes associated with activation and/or differentiation of macrophages. The cytogenetic location of this locus has been reported as both 8p11 and 8q11. [provided by RefSeq, Sep 2010]
Write Your Own Review
You're reviewing:CEBPD (NM_005195) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC211266L1 Lenti ORF clone of Human CCAAT/enhancer binding protein (C/EBP), delta (CEBPD), Myc-DDK-tagged 10 ug
$600.00
RC211266L2 Lenti ORF clone of Human CCAAT/enhancer binding protein (C/EBP), delta (CEBPD), mGFP tagged 10 ug
$600.00
RC211266L3 Lenti ORF clone of Human CCAAT/enhancer binding protein (C/EBP), delta (CEBPD), Myc-DDK-tagged 10 ug
$600.00
RC211266L4 Lenti ORF clone of Human CCAAT/enhancer binding protein (C/EBP), delta (CEBPD), mGFP tagged 10 ug
$600.00
RG211266 CEBPD (tGFP-tagged) - Human CCAAT/enhancer binding protein (C/EBP), delta (CEBPD) 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC110852 CEBPD (untagged)-Human CCAAT/enhancer binding protein (C/EBP), delta (CEBPD) 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.