MED9 (NM_018019) Human Tagged ORF Clone

SKU
RC211226
MED9 (Myc-DDK-tagged)-Human mediator complex subunit 9 (MED9)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$150.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol MED9
Synonyms MED25
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC211226 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCCTCTGCTGGGGTGGCAGCCGGGCGACAGGCGGAGGATGTATTGCCGCCAACGTCCGACCAGCCGC
TGCCTGACACCAAGCCGCTGCCGCCTCCTCAGCCGCCGCCGGTCCCTGCGCCTCAACCGCAGCAGTCGCC
GGCGCCACGGCCTCAGTCACCTGCCCGCGCGAGGGAGGAAGAGAACTACTCCTTTTTACCTTTGGTTCAC
AACATCATCAAATGCATGGACAAGGACAGCCCGGAGGTCCACCAGGACCTGAACGCCCTCAAAAGCAAGT
TCCAGGAGATGCGCAAGCTCATCAGCACCATGCCCGGCATCCACCTGAGCCCCGAACAGCAGCAGCAGCA
GCTGCAGAGCCTCCGGGAGCAAGTCAGGACCAAGAATGAGCTTCTGCAAAAGTACAAGAGCCTCTGCATG
TTCGAAATCCCCAAGGAG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC211226 protein sequence
Red=Cloning site Green=Tags(s)

MASAGVAAGRQAEDVLPPTSDQPLPDTKPLPPPQPPPVPAPQPQQSPAPRPQSPARAREEENYSFLPLVH
NIIKCMDKDSPEVHQDLNALKSKFQEMRKLISTMPGIHLSPEQQQQQLQSLREQVRTKNELLQKYKSLCM
FEIPKE

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_018019
ORF Size 438 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_018019.3
RefSeq Size 2222 bp
RefSeq ORF 441 bp
Locus ID 55090
UniProt ID Q9NWA0
Cytogenetics 17p11.2
MW 16.4 kDa
Summary The multiprotein Mediator complex is a coactivator required for activation of RNA polymerase II transcription by DNA bound transcription factors. The protein encoded by this gene is thought to be a subunit of the Mediator complex. This gene is located within the Smith-Magenis syndrome region on chromosome 17. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:MED9 (NM_018019) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC211226L3 Lenti ORF clone of Human mediator complex subunit 9 (MED9), Myc-DDK-tagged 10 ug
$450.00
RC211226L4 Lenti ORF clone of Human mediator complex subunit 9 (MED9), mGFP tagged 10 ug
$450.00
RG211226 MED9 (tGFP-tagged) - Human mediator complex subunit 9 (MED9) 10 ug
$489.00
SC113804 MED9 (untagged)-Human mediator complex subunit 9 (MED9) 10 ug
$150.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.