EN2 (NM_001427) Human Tagged ORF Clone

SKU
RC211220
EN2 (Myc-DDK-tagged)-Human engrailed homeobox 2 (EN2)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$450.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol EN2
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC211220 representing NM_001427
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAGGAGAATGACCCCAAGCCTGGCGAAGCAGCGGCGGCGGTGGAGGGACAGCGGCAGCCGGAATCCA
GCCCCGGCGGCGGCTCGGGCGGCGGCGGCGGTAGCAGCCCAGGCGAAGCGGACACCGGGCGCCGGCGGGC
TCTGATGCTGCCCGCGGTCCTGCAGGCGCCCGGCAACCACCAGCACCCGCACCGCATCACCAACTTCTTC
ATCGACAACATCCTGCGGCCCGAGTTCGGCCGGCGAAAGGACGCGGGGACCTGCTGTGCGGGCGCGGGAG
GAGGAAGGGGCGGCGGAGCCGGCGGCGAAGGCGGCGCGAGCGGTGCGGAGGGAGGCGGCGGCGCGGGCGG
CTCGGAGCAGCTCTTGGGCTCGGGCTCCCGAGAGCCCCGGCAGAACCCGCCATGTGCGCCCGGCGCGGGC
GGGCCGCTCCCAGCCGCCGGCAGCGACTCTCCGGGTGACGGGGAAGGCGGCTCCAAGACGCTCTCGCTGC
ACGGTGGCGCCAAGAAAGGCGGCGACCCCGGCGGCCCCCTGGACGGGTCGCTCAAGGCCCGCGGCTTGGG
CGGCGGCGACCTGTCGGTGAGCTCGGACTCGGACAGCTCGCAAGCCGGCGCCAACCTGGGCGCGCAGCCC
ATGCTCTGGCCGGCGTGGGTCTACTGTACGCGCTACTCGGACCGGCCTTCTTCAGGTCCCAGGTCTCGAA
AACCAAAGAAGAAGAACCCGAACAAAGAGGACAAGCGGCCGCGCACGGCCTTTACCGCCGAGCAGCTGCA
GAGGCTCAAGGCCGAGTTCCAGACCAACAGGTACCTGACGGAGCAGCGGCGCCAGAGCCTGGCGCAGGAG
CTGAGCCTCAACGAGTCACAGATCAAGATTTGGTTCCAGAACAAGCGCGCCAAGATCAAGAAGGCCACGG
GCAACAAGAACACGCTGGCCGTGCACCTCATGGCACAGGGCTTGTACAACCACTCCACCACAGCCAAGGA
GGGCAAGTCGGACAGCGAG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC211220 representing NM_001427
Red=Cloning site Green=Tags(s)

MEENDPKPGEAAAAVEGQRQPESSPGGGSGGGGGSSPGEADTGRRRALMLPAVLQAPGNHQHPHRITNFF
IDNILRPEFGRRKDAGTCCAGAGGGRGGGAGGEGGASGAEGGGGAGGSEQLLGSGSREPRQNPPCAPGAG
GPLPAAGSDSPGDGEGGSKTLSLHGGAKKGGDPGGPLDGSLKARGLGGGDLSVSSDSDSSQAGANLGAQP
MLWPAWVYCTRYSDRPSSGPRSRKPKKKNPNKEDKRPRTAFTAEQLQRLKAEFQTNRYLTEQRRQSLAQE
LSLNESQIKIWFQNKRAKIKKATGNKNTLAVHLMAQGLYNHSTTAKEGKSDSE

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_001427
ORF Size 999 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_001427.2, NP_001418.2
RefSeq Size 3405 bp
RefSeq ORF 1002 bp
Locus ID 2020
UniProt ID P19622
Cytogenetics 7q36.3
Protein Families Druggable Genome, ES Cell Differentiation/IPS
MW 34 kDa
Summary Homeobox-containing genes are thought to have a role in controlling development. In Drosophila, the 'engrailed' (en) gene plays an important role during development in segmentation, where it is required for the formation of posterior compartments. Different mutations in the mouse homologs, En1 and En2, produced different developmental defects that frequently are lethal. The human engrailed homologs 1 and 2 encode homeodomain-containing proteins and have been implicated in the control of pattern formation during development of the central nervous system. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:EN2 (NM_001427) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC211220L1 Lenti ORF clone of Human engrailed homeobox 2 (EN2), Myc-DDK-tagged 10 ug
$750.00
RC211220L2 Lenti ORF clone of Human engrailed homeobox 2 (EN2), mGFP tagged 10 ug
$750.00
RC211220L3 Lenti ORF clone of Human engrailed homeobox 2 (EN2), Myc-DDK-tagged 10 ug
$750.00
RC211220L4 Lenti ORF clone of Human engrailed homeobox 2 (EN2), mGFP tagged 10 ug
$750.00
RG211220 EN2 (tGFP-tagged) - Human engrailed homeobox 2 (EN2) 10 ug
$650.00
SC303017 EN2 (untagged)-Human engrailed homeobox 2 (EN2) 10 ug
$1,482.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.