KRTAP22-1 (NM_181620) Human Tagged ORF Clone

SKU
RC210980
KRTAP22 (Myc-DDK-tagged)-Human keratin associated protein 22-1 (KRTAP22-1)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$150.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol KRTAP22-1
Synonyms KAP22.1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC210980 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAGCTTTGATAACAACTACCATGGTGGCCAGGGCTATGCCAAAGGAGGCCTGGGCTGCAGCTATGGCT
GTGGTCATAGCGGCTATGGCTATGCCTGCTACTGCCCATGGTGTTATGAAAGATCTTGGTTTTCTGGCTG
CTTC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC210980 protein sequence
Red=Cloning site Green=Tags(s)

MSFDNNYHGGQGYAKGGLGCSYGCGHSGYGYACYCPWCYERSWFSGCF

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_181620
ORF Size 144 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_181620.1, NP_853651.1
RefSeq Size 147 bp
RefSeq ORF 147 bp
Locus ID 337979
UniProt ID Q3MIV0
Cytogenetics 21q22.11
MW 5.3 kDa
Summary In the hair cortex, hair keratin intermediate filaments are embedded in an interfilamentous matrix, consisting of hair keratin-associated proteins (KRTAP), which are essential for the formation of a rigid and resistant hair shaft through their extensive disulfide bond cross-linking with abundant cysteine residues of hair keratins. The matrix proteins include the high-sulfur and high-glycine-tyrosine keratins.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:KRTAP22-1 (NM_181620) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC210980L3 Lenti ORF clone of Human keratin associated protein 22-1 (KRTAP22-1), Myc-DDK-tagged 10 ug
$450.00
RC210980L4 Lenti ORF clone of Human keratin associated protein 22-1 (KRTAP22-1), mGFP tagged 10 ug
$450.00
RG210980 KRTAP22 (tGFP-tagged) - Human keratin associated protein 22-1 (KRTAP22-1) 10 ug
$489.00
SC307330 KRTAP22 (untagged)-Human keratin associated protein 22-1 (KRTAP22-1) 10 ug
$165.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.