ERP29 (NM_006817) Human Tagged ORF Clone

SKU
RC210918
ERP29 (Myc-DDK-tagged)-Human endoplasmic reticulum protein 29 (ERP29), transcript variant 1
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol ERP29
Synonyms C12orf8; ERp28; ERp31; HEL-S-107; PDI-DB; PDIA9
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC210918 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCTGCCGCTGTGCCCCGCGCCGCATTTCTCTCCCCGCTGCTTCCCCTTCTCCTGGGCTTCCTGCTCC
TCTCCGCTCCGCATGGCGGCAGCGGCCTGCACACCAAGGGCGCCCTTCCCCTGGATACGGTCACTTTCTA
CAAGGTCATTCCCAAAAGCAAGTTCGTCTTGGTGAAGTTCGACACCCAGTACCCCTACGGTGAGAAGCAG
GATGAGTTCAAGCGTCTTGCTGAAAACTCGGCTTCCAGCGATGATCTCTTGGTGGCAGAGGTGGGGATCT
CAGATTATGGTGACAAGCTGAACATGGAGCTGAGTGAGAAATACAAGCTGGACAAAGAGAGCTACCCAGT
CTTCTACCTCTTCCGGGATGGGGACTTTGAGAACCCAGTCCCATACACTGGGGCAGTTAAGGTTGGAGCC
ATCCAGCGCTGGCTGAAGGGGCAAGGGGTCTACCTAGGTATGCCTGGTTGCCTGCCTGTATACGACGCCC
TGGCCGGGGAGTTCATCAGGGCCTCTGGTGTGGAGGCCCGCCAGGCCCTCTTGAAGCAGGGGCAAGATAA
CCTCTCAAGTGTGAAGGAGACTCAGAAGAAGTGGGCCGAGCAATACCTGAAGATCATGGGGAAGATCTTA
GACCAAGGGGAGGACTTCCCAGCATCAGAGATGACACGGATCGCCAGGCTGATTGAGAAGAACAAGATGA
GTGACGGGAAGAAGGAGGAGCTCCAGAAGAGCTTAAACATCCTGACTGCCTTCCAGAAGAAGGGGGCCGA
GAAAGAGGAGCTG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC210918 protein sequence
Red=Cloning site Green=Tags(s)

MAAAVPRAAFLSPLLPLLLGFLLLSAPHGGSGLHTKGALPLDTVTFYKVIPKSKFVLVKFDTQYPYGEKQ
DEFKRLAENSASSDDLLVAEVGISDYGDKLNMELSEKYKLDKESYPVFYLFRDGDFENPVPYTGAVKVGA
IQRWLKGQGVYLGMPGCLPVYDALAGEFIRASGVEARQALLKQGQDNLSSVKETQKKWAEQYLKIMGKIL
DQGEDFPASEMTRIARLIEKNKMSDGKKEELQKSLNILTAFQKKGAEKEEL

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_006817
ORF Size 783 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_006817.4
RefSeq Size 1472 bp
RefSeq ORF 786 bp
Locus ID 10961
UniProt ID P30040
Cytogenetics 12q24.13
Protein Families Transmembrane
MW 29 kDa
Summary This gene encodes a protein which localizes to the lumen of the endoplasmic reticulum (ER). It is a member of the protein disulfide isomerase (PDI) protein family but lacks an active thioredoxin motif, suggesting that this protein does not function as a disulfide isomerase. The canonical protein dimerizes and is thought to play a role in the processing of secretory proteins within the ER. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Dec 2016]
Write Your Own Review
You're reviewing:ERP29 (NM_006817) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC210918L1 Lenti ORF clone of Human endoplasmic reticulum protein 29 (ERP29), transcript variant 1, Myc-DDK-tagged 10 ug
$600.00
RC210918L2 Lenti ORF clone of Human endoplasmic reticulum protein 29 (ERP29), transcript variant 1, mGFP tagged 10 ug
$600.00
RC210918L3 Lenti ORF clone of Human endoplasmic reticulum protein 29 (ERP29), transcript variant 1, Myc-DDK-tagged 10 ug
$600.00
RC210918L4 Lenti ORF clone of Human endoplasmic reticulum protein 29 (ERP29), transcript variant 1, mGFP tagged 10 ug
$600.00
RG210918 ERP29 (tGFP-tagged) - Human endoplasmic reticulum protein 29 (ERP29), transcript variant 1 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC128143 ERP29 (untagged)-Human endoplasmic reticulum protein 29 (ERP29), transcript variant 1 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.