CD37 (NM_001774) Human Tagged ORF Clone

SKU
RC210768
CD37 (Myc-DDK-tagged)-Human CD37 molecule (CD37), transcript variant 1
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol CD37
Synonyms GP52-40; TSPAN26
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC210768 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCAGCCCAGGAGAGCTGCCTCAGCCTCATCAAGTACTTCCTCTTCGTTTTCAACCTCTTCTTCTTCG
TCCTCGGCAGCCTGATCTTCTGCTTCGGCATCTGGATCCTCATCGACAAGACCAGCTTCGTGTCCTTTGT
GGGCTTGGCCTTCGTGCCTCTGCAGATCTGGTCCAAAGTCCTGGCCATCTCAGGAATCTTCACCATGGGC
ATCGCCCTCCTGGGTTGTGTGGGGGCCCTCAAGGAGCTCCGCTGCCTCCTGGGCCTGTATTTTGGGATGC
TGCTGCTCCTGTTTGCCACACAGATCACCCTGGGAATCCTCATCTCCACTCAGCGGGCCCAGCTGGAGCG
AAGCTTGCGGGACGTCGTAGAGAAAACCATCCAAAAGTACGGCACCAACCCCGAGGAGACCGCGGCCGAG
GAGAGCTGGGACTATGTGCAGTTCCAGCTGCGCTGCTGCGGCTGGCACTACCCGCAGGACTGGTTCCAAG
TCCTCATCCTGAGAGGTAACGGGTCGGAGGCGCACCGCGTGCCCTGCTCCTGCTACAACTTGTCGGCGAC
CAACGACTCCACAATCCTAGATAAGGTGATCTTGCCCCAGCTCAGCAGGCTTGGACACCTGGCGCGGTCC
AGACACAGTGCAGACATCTGCGCTGTCCCTGCAGAGAGCCACATCTACCGCGAGGGCTGCGCGCAGGGCC
TCCAGAAGTGGCTGCACAACAACCTTATTTCCATAGTGGGCATTTGCCTGGGCGTCGGCCTACTCGAGCT
CGGGTTCATGACGCTCTCGATATTCCTGTGCAGAAACCTGGACCACGTCTACAACCGGCTCGCTCGATAC
CGT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC210768 protein sequence
Red=Cloning site Green=Tags(s)

MSAQESCLSLIKYFLFVFNLFFFVLGSLIFCFGIWILIDKTSFVSFVGLAFVPLQIWSKVLAISGIFTMG
IALLGCVGALKELRCLLGLYFGMLLLLFATQITLGILISTQRAQLERSLRDVVEKTIQKYGTNPEETAAE
ESWDYVQFQLRCCGWHYPQDWFQVLILRGNGSEAHRVPCSCYNLSATNDSTILDKVILPQLSRLGHLARS
RHSADICAVPAESHIYREGCAQGLQKWLHNNLISIVGICLGVGLLELGFMTLSIFLCRNLDHVYNRLARY
R

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_001774
ORF Size 843 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_001774.1, NP_001765.1
RefSeq Size 1263 bp
RefSeq ORF 846 bp
Locus ID 951
UniProt ID P11049
Cytogenetics 19q13.33
Domains transmembrane4
Protein Families Transmembrane
Protein Pathways Hematopoietic cell lineage
MW 31.7 kDa
Summary The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. This encoded protein is a cell surface glycoprotein that is known to complex with integrins and other transmembrane 4 superfamily proteins. It may play a role in T-cell-B-cell interactions. Alternate splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:CD37 (NM_001774) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC210768L1 Lenti ORF clone of Human CD37 molecule (CD37), transcript variant 1, Myc-DDK-tagged 10 ug
$600.00
RC210768L2 Lenti ORF clone of Human CD37 molecule (CD37), transcript variant 1, mGFP tagged 10 ug
$600.00
RC210768L3 Lenti ORF clone of Human CD37 molecule (CD37), transcript variant 1, Myc-DDK-tagged 10 ug
$600.00
RC210768L4 Lenti ORF clone of Human CD37 molecule (CD37), transcript variant 1, mGFP tagged 10 ug
$600.00
RG210768 CD37 (tGFP-tagged) - Human CD37 molecule (CD37), transcript variant 1 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC119046 CD37 (untagged)-Human CD37 molecule (CD37), transcript variant 1 10 ug
$457.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.