DUT (NM_001025249) Human Tagged ORF Clone

SKU
RC210600
DUT (Myc-DDK-tagged)-Human deoxyuridine triphosphatase (DUT), nuclear gene encoding mitochondrial protein, transcript variant 3
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol DUT
Synonyms dUTPase
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC210600 representing NM_001025249
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGACTCCCCTCTGCCCTCGCCCCGCGCTCTGCTACCATTTCCTTACGTCTCTGCTTCGCTCAGCGATGC
AAAACGCGCGAGGCGCACGGCAGAGGGCCGAAGCCGCGGTACTCTCCGGGCCAGGCCCGCCCCTCGGCCG
CGCCGCGCAGCACGGGATTCCCCGGCCGCTGTCCAGCGCTGGCCGCCTGAGCCAAGGCTGCCGCGGAGCC
AGTACAGTCGGGGCCGCTGGCTGGAAGGGCGAGCTTCCTAAGGCGGGGGGAAGCCCGGCGCCGGGGCCGG
AGACACCCGCCATTTCACCCAGTAAGCGGGCCCGGCCTGCGGAGGTGGGCGGCATGCAGCTCCGCTTTGC
CCGGCTCTCCGAGCACGCCACGGCCCCCACCCGGGGCTCCGCGCGCGCCGCGGGCTACGACCTGTACAGT
GCCTATGATTACACAATACCACCTATGGAGAAAGCTGTTGTGAAAACGGACATTCAGATAGCGCTCCCTT
CTGGGTGTTATGGAAGAGTGGCTCCACGGTCAGGCTTGGCTGCAAAACACTTTATTGATGTAGGAGCTGG
TGTCATAGATGAAGATTATAGAGGAAATGTTGGTGTTGTACTGTTTAATTTTGGCAAAGAAAAGTTTGAA
GTCAAAAAAGGTGATCGAATTGCACAGCTCATTTGCGAACGGATTTTTTATCCAGAAATAGAAGAAGTTC
AAGCCTTGGATGACACCGAAAGGGGTTCAGGAGGTTTTGGTTCCACTGGAAAGAAT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC210600 representing NM_001025249
Red=Cloning site Green=Tags(s)

MTPLCPRPALCYHFLTSLLRSAMQNARGARQRAEAAVLSGPGPPLGRAAQHGIPRPLSSAGRLSQGCRGA
STVGAAGWKGELPKAGGSPAPGPETPAISPSKRARPAEVGGMQLRFARLSEHATAPTRGSARAAGYDLYS
AYDYTIPPMEKAVVKTDIQIALPSGCYGRVAPRSGLAAKHFIDVGAGVIDEDYRGNVGVVLFNFGKEKFE
VKKGDRIAQLICERIFYPEIEEVQALDDTERGSGGFGSTGKN

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_001025249
ORF Size 756 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq Size 1830 bp
RefSeq ORF 426 bp
Locus ID 1854
UniProt ID P33316
Cytogenetics 15q21.1
Protein Families Druggable Genome
Protein Pathways Metabolic pathways, Pyrimidine metabolism
MW 26.56 kDa
Summary This gene encodes an essential enzyme of nucleotide metabolism. The encoded protein forms a ubiquitous, homotetrameric enzyme that hydrolyzes dUTP to dUMP and pyrophosphate. This reaction serves two cellular purposes: providing a precursor (dUMP) for the synthesis of thymine nucleotides needed for DNA replication, and limiting intracellular pools of dUTP. Elevated levels of dUTP lead to increased incorporation of uracil into DNA, which induces extensive excision repair mediated by uracil glycosylase. This repair process, resulting in the removal and reincorporation of dUTP, is self-defeating and leads to DNA fragmentation and cell death. Alternative splicing of this gene leads to different isoforms that localize to either the mitochondrion or nucleus. A related pseudogene is located on chromosome 19. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:DUT (NM_001025249) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC210600L1 Lenti ORF clone of Human deoxyuridine triphosphatase (DUT), nuclear gene encoding mitochondrial protein, transcript variant 3, Myc-DDK-tagged 10 ug
$600.00
RC210600L2 Lenti ORF clone of Human deoxyuridine triphosphatase (DUT), nuclear gene encoding mitochondrial protein, transcript variant 3, mGFP tagged 10 ug
$600.00
RC210600L3 Lenti ORF clone of Human deoxyuridine triphosphatase (DUT), nuclear gene encoding mitochondrial protein, transcript variant 3, Myc-DDK-tagged 10 ug
$600.00
RC210600L4 Lenti ORF clone of Human deoxyuridine triphosphatase (DUT), nuclear gene encoding mitochondrial protein, transcript variant 3, mGFP tagged 10 ug
$600.00
RG210600 DUT (tGFP-tagged) - Human deoxyuridine triphosphatase (DUT), nuclear gene encoding mitochondrial protein, transcript variant 3 10 ug
$500.00
SC302383 DUT (untagged)-Human deoxyuridine triphosphatase (DUT), nuclear gene encoding mitochondrial protein, transcript variant 3 10 ug
$165.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.