SNRPE (NM_003094) Human Tagged ORF Clone

SKU
RC210556
SNRPE (Myc-DDK-tagged)-Human small nuclear ribonucleoprotein polypeptide E (SNRPE)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$150.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol SNRPE
Synonyms HYPT11; Sm-E; SME; snRNP-E
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC210556 representing NM_003094
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGTACCGTGGCCAGGGTCAGAAAGTGCAGAAGGTTATGGTGCAGCCCATCAACCTCATCTTCAGAT
ACTTACAAAATAGATCGCGGATTCAGGTGTGGCTCTATGAGCAAGTGAATATGCGGATAGAAGGCTGTAT
CATTGGTTTTGATGAGTATATGAACCTTGTATTAGATGATGCAGAAGAGATTCATTCTAAAACAAAGTCA
AGAAAACAACTGGGTCGGATCATGCTAAAAGGAGATAATATTACTCTGCTACAAAGTGTCTCCAAC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC210556 representing NM_003094
Red=Cloning site Green=Tags(s)

MAYRGQGQKVQKVMVQPINLIFRYLQNRSRIQVWLYEQVNMRIEGCIIGFDEYMNLVLDDAEEIHSKTKS
RKQLGRIMLKGDNITLLQSVSN

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_003094
ORF Size 276 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_003094.4
RefSeq Size 1593 bp
RefSeq ORF 279 bp
Locus ID 6635
UniProt ID P62304
Cytogenetics 1q32.1
Domains Sm
Protein Families Stem cell - Pluripotency
Protein Pathways Spliceosome
MW 10.6 kDa
Summary The protein encoded by this gene is a core component of U small nuclear ribonucleoproteins, which are key components of the pre-mRNA processing spliceosome. The encoded protein plays a role in the 3' end processing of histone transcripts. This protein is one of the targets in the autoimmune disease systemic lupus erythematosus, and mutations in this gene have been associated with hypotrichosis. Several pseudogenes of this gene have been identified. [provided by RefSeq, Jun 2016]
Write Your Own Review
You're reviewing:SNRPE (NM_003094) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC210556L3 Lenti ORF clone of Human small nuclear ribonucleoprotein polypeptide E (SNRPE), Myc-DDK-tagged 10 ug
$450.00
RC210556L4 Lenti ORF clone of Human small nuclear ribonucleoprotein polypeptide E (SNRPE), mGFP tagged 10 ug
$450.00
RG210556 SNRPE (tGFP-tagged) - Human small nuclear ribonucleoprotein polypeptide E (SNRPE) 10 ug
$489.00
SC118227 SNRPE (untagged)-Human small nuclear ribonucleoprotein polypeptide E (SNRPE) 10 ug
$150.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.