NEDD8 (NM_006156) Human Tagged ORF Clone
SKU
RC210479
NEDD8 (Myc-DDK-tagged)-Human neural precursor cell expressed, developmentally down-regulated 8 (NEDD8)
-
TrueORF®
TrueORF®
Expression-ready ORF plasmid with C-terminal tag(s)
Click here to learn more.
Product Data | |
Type | Human Tagged ORF Clone |
---|---|
Target Symbol | NEDD8 |
Synonyms | NEDD-8 |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
ORF Nucleotide Sequence
>RC210479 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGCTAATTAAAGTGAAGACGCTGACCGGAAAGGAGATTGAGATTGACATTGAACCTACAGACAAGGTGG AGCGAATCAAGGAGCGTGTGGAGGAGAAAGAGGGAATCCCCCCACAACAGCAGAGGCTCATCTACAGTGG CAAGCAGATGAATGATGAGAAGACAGCAGCTGATTACAAGATTTTAGGTGGTTCAGTCCTTCACCTGGTG TTGGCTCTGAGAGGAGGAGGTGGTCTTAGGCAG ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>RC210479 protein sequence
Red=Cloning site Green=Tags(s) MLIKVKTLTGKEIEIDIEPTDKVERIKERVEEKEGIPPQQQRLIYSGKQMNDEKTAADYKILGGSVLHLV LALRGGGGLRQ myc-FLAG tag |
Chromatograms |
Chromatograms
![]() Sequencher program is needed, download here |
Restriction Sites |
SgfI-MluI Cloning Scheme for this gene
Plasmid Map
![]() |
ACCN | NM_006156 |
ORF Size | 243 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution Method | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Note | Plasmids are not sterile. For experiments where strict sterility is required, filtration with 0.22um filter is required. |
Shipping | Ambient |
Reference Data | |
RefSeq | NM_006156.3 |
RefSeq Size | 625 bp |
RefSeq ORF | 246 bp |
Locus ID | 4738 |
UniProt ID | Q15843 |
Cytogenetics | 14q12 |
Protein Families | Druggable Genome |
MW | 9.1 kDa |
Summary | Ubiquitin-like protein which plays an important role in cell cycle control and embryogenesis. Covalent attachment to its substrates requires prior activation by the E1 complex UBE1C-APPBP1 and linkage to the E2 enzyme UBE2M. Attachment of NEDD8 to cullins activates their associated E3 ubiquitin ligase activity, and thus promotes polyubiquitination and proteasomal degradation of cyclins and other regulatory proteins.[UniProtKB/Swiss-Prot Function] |
Write Your Own Review
Product Manuals |
FAQs |
SDS |
SKU | Description | Size | Price | |
---|---|---|---|---|
RC210479L1 | Lenti ORF clone of Human neural precursor cell expressed, developmentally down-regulated 8 (NEDD8), Myc-DDK-tagged | 10 ug |
$450.00
|
|
RC210479L2 | Lenti ORF clone of Human neural precursor cell expressed, developmentally down-regulated 8 (NEDD8), mGFP tagged | 10 ug |
$450.00
|
|
RC210479L3 | Lenti ORF clone of Human neural precursor cell expressed, developmentally down-regulated 8 (NEDD8), Myc-DDK-tagged | 10 ug |
$450.00
|
|
RC210479L4 | Lenti ORF clone of Human neural precursor cell expressed, developmentally down-regulated 8 (NEDD8), mGFP tagged | 10 ug |
$450.00
|
|
RG210479 | NEDD8 (tGFP-tagged) - Human neural precursor cell expressed, developmentally down-regulated 8 (NEDD8) | 10 ug |
$489.00
|
|
SC110960 | NEDD8 (untagged)-Human neural precursor cell expressed, developmentally down-regulated 8 (NEDD8) | 10 ug |
$150.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.