NEDD8 (NM_006156) Human Tagged ORF Clone

SKU
RC210479
NEDD8 (Myc-DDK-tagged)-Human neural precursor cell expressed, developmentally down-regulated 8 (NEDD8)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$289.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol NEDD8
Synonyms NEDD-8
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC210479 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCTAATTAAAGTGAAGACGCTGACCGGAAAGGAGATTGAGATTGACATTGAACCTACAGACAAGGTGG
AGCGAATCAAGGAGCGTGTGGAGGAGAAAGAGGGAATCCCCCCACAACAGCAGAGGCTCATCTACAGTGG
CAAGCAGATGAATGATGAGAAGACAGCAGCTGATTACAAGATTTTAGGTGGTTCAGTCCTTCACCTGGTG
TTGGCTCTGAGAGGAGGAGGTGGTCTTAGGCAG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC210479 protein sequence
Red=Cloning site Green=Tags(s)

MLIKVKTLTGKEIEIDIEPTDKVERIKERVEEKEGIPPQQQRLIYSGKQMNDEKTAADYKILGGSVLHLV
LALRGGGGLRQ

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_006156
ORF Size 243 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_006156.3
RefSeq Size 625 bp
RefSeq ORF 246 bp
Locus ID 4738
UniProt ID Q15843
Cytogenetics 14q12
Protein Families Druggable Genome
MW 9.1 kDa
Summary Ubiquitin-like protein which plays an important role in cell cycle control and embryogenesis. Covalent attachment to its substrates requires prior activation by the E1 complex UBE1C-APPBP1 and linkage to the E2 enzyme UBE2M. Attachment of NEDD8 to cullins activates their associated E3 ubiquitin ligase activity, and thus promotes polyubiquitination and proteasomal degradation of cyclins and other regulatory proteins.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:NEDD8 (NM_006156) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC210479L1 Lenti ORF clone of Human neural precursor cell expressed, developmentally down-regulated 8 (NEDD8), Myc-DDK-tagged 10 ug
$450.00
RC210479L2 Lenti ORF clone of Human neural precursor cell expressed, developmentally down-regulated 8 (NEDD8), mGFP tagged 10 ug
$450.00
RC210479L3 Lenti ORF clone of Human neural precursor cell expressed, developmentally down-regulated 8 (NEDD8), Myc-DDK-tagged 10 ug
$450.00
RC210479L4 Lenti ORF clone of Human neural precursor cell expressed, developmentally down-regulated 8 (NEDD8), mGFP tagged 10 ug
$450.00
RG210479 NEDD8 (tGFP-tagged) - Human neural precursor cell expressed, developmentally down-regulated 8 (NEDD8) 10 ug
$489.00
SC110960 NEDD8 (untagged)-Human neural precursor cell expressed, developmentally down-regulated 8 (NEDD8) 10 ug
$150.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.