MCP3 (CCL7) (NM_006273) Human Tagged ORF Clone

SKU
RC210469
CCL7 (Myc-DDK-tagged)-Human chemokine (C-C motif) ligand 7 (CCL7)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$289.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol MCP3
Synonyms FIC; MARC; MCP-3; MCP3; NC28; SCYA6; SCYA7
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC210469 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAAAGCCTCTGCAGCACTTCTGTGTCTGCTGCTCACAGCAGCTGCTTTCAGCCCCCAGGGGCTTGCTC
AGCCAGTTGGGATTAATACTTCAACTACCTGCTGCTACAGATTTATCAATAAGAAAATCCCTAAGCAGAG
GCTGGAGAGCTACAGAAGGACCACCAGTAGCCACTGTCCCCGGGAAGCTGTAATCTTCAAGACCAAACTG
GACAAGGAGATCTGTGCTGACCCCACACAGAAGTGGGTCCAGGACTTTATGAAGCACCTGGACAAGAAAA
CCCAAACTCCAAAGCTT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC210469 protein sequence
Red=Cloning site Green=Tags(s)

MKASAALLCLLLTAAAFSPQGLAQPVGINTSTTCCYRFINKKIPKQRLESYRRTTSSHCPREAVIFKTKL
DKEICADPTQKWVQDFMKHLDKKTQTPKL

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_006273
ORF Size 297 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_006273.4
RefSeq Size 815 bp
RefSeq ORF 300 bp
Locus ID 6354
UniProt ID P80098
Cytogenetics 17q12
Protein Families Druggable Genome, Secreted Protein
Protein Pathways Chemokine signaling pathway, Cytokine-cytokine receptor interaction, NOD-like receptor signaling pathway
MW 11.2 kDa
Summary This gene encodes monocyte chemotactic protein 3, a secreted chemokine which attracts macrophages during inflammation and metastasis. It is a member of the C-C subfamily of chemokines which are characterized by having two adjacent cysteine residues. The protein is an in vivo substrate of matrix metalloproteinase 2, an enzyme which degrades components of the extracellular matrix. This gene is part of a cluster of C-C chemokine family members on chromosome 17q. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:MCP3 (CCL7) (NM_006273) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC210469L3 Lenti ORF clone of Human chemokine (C-C motif) ligand 7 (CCL7), Myc-DDK-tagged 10 ug
$450.00
RC210469L4 Lenti ORF clone of Human chemokine (C-C motif) ligand 7 (CCL7), mGFP tagged 10 ug
$450.00
RG210469 CCL7 (tGFP-tagged) - Human chemokine (C-C motif) ligand 7 (CCL7) 10 ug
$350.00
SC303764 CCL7 (untagged)-Human chemokine (C-C motif) ligand 7 (CCL7) 10 ug
$150.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.