eIF1A (EIF1AX) (NM_001412) Human Tagged ORF Clone

SKU
RC210335
EIF1AX (Myc-DDK-tagged)-Human eukaryotic translation initiation factor 1A, X-linked (EIF1AX)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$150.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol eIF1A
Synonyms eIF-1A; eIF-4C; EIF1A; EIF1AP1; EIF4C
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC210335 representing NM_001412
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCCCAAGAATAAAGGTAAAGGAGGTAAAAACAGACGCAGGGGTAAGAATGAGAATGAATCTGAAAAAA
GAGAACTGGTATTCAAAGAGGATGGTCAGGAGTATGCTCAGGTAATCAAAATGTTGGGAAATGGACGGCT
AGAAGCAATGTGTTTCGATGGTGTAAAGAGGTTATGTCACATCAGAGGAAAATTGAGAAAAAAGGTTTGG
ATAAATACCTCGGACATTATTTTGGTTGGTCTCCGAGACTACCAGGATAACAAAGCTGATGTAATTTTAA
AATACAATGCAGACGAAGCTAGAAGTCTGAAGGCATACGGCGAGCTTCCAGAGCATGCTAAAATCAATGA
AACTGATACATTTGGTCCTGGAGATGATGATGAAATTCAGTTTGATGACATTGGAGATGATGATGAAGAT
ATTGATGACATC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC210335 representing NM_001412
Red=Cloning site Green=Tags(s)

MPKNKGKGGKNRRRGKNENESEKRELVFKEDGQEYAQVIKMLGNGRLEAMCFDGVKRLCHIRGKLRKKVW
INTSDIILVGLRDYQDNKADVILKYNADEARSLKAYGELPEHAKINETDTFGPGDDDEIQFDDIGDDDED
IDDI

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_001412
ORF Size 432 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_001412.4
RefSeq Size 4431 bp
RefSeq ORF 435 bp
Locus ID 1964
UniProt ID P47813
Cytogenetics Xp22.12
Domains eIF-1a
MW 16.3 kDa
Summary This gene encodes an essential eukaryotic translation initiation factor. The protein is required for the binding of the 43S complex (a 40S subunit, eIF2/GTP/Met-tRNAi and eIF3) to the 5' end of capped RNA. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:eIF1A (EIF1AX) (NM_001412) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC210335L1 Lenti ORF clone of Human eukaryotic translation initiation factor 1A, X-linked (EIF1AX), Myc-DDK-tagged 10 ug
$450.00
RC210335L2 Lenti ORF clone of Human eukaryotic translation initiation factor 1A, X-linked (EIF1AX), mGFP tagged 10 ug
$450.00
RC210335L3 Lenti ORF clone of Human eukaryotic translation initiation factor 1A, X-linked (EIF1AX), Myc-DDK-tagged 10 ug
$450.00
RC210335L4 Lenti ORF clone of Human eukaryotic translation initiation factor 1A, X-linked (EIF1AX), mGFP tagged 10 ug
$450.00
RG210335 EIF1AX (tGFP-tagged) - Human eukaryotic translation initiation factor 1A, X-linked (EIF1AX) 10 ug
$489.00
SC127349 EIF1AX (untagged)-Human eukaryotic translation initiation factor 1A, X-linked (EIF1AX) 10 ug
$1,263.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.