CXCL11 (NM_005409) Human Tagged ORF Clone

SKU
RC210320
CXCL11 (Myc-DDK-tagged)-Human chemokine (C-X-C motif) ligand 11 (CXCL11)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$289.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol CXCL11
Synonyms b-R1; H174; I-TAC; IP-9; IP9; SCYB9B; SCYB11
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC210320 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAGTGTGAAGGGCATGGCTATAGCCTTGGCTGTGATATTGTGTGCTACAGTTGTTCAAGGCTTCCCCA
TGTTCAAAAGAGGACGCTGTCTTTGCATAGGCCCTGGGGTAAAAGCAGTGAAAGTGGCAGATATTGAGAA
AGCCTCCATAATGTACCCAAGTAACAACTGTGACAAAATAGAAGTGATTATTACCCTGAAAGAAAATAAA
GGACAACGATGCCTAAATCCCAAATCGAAGCAAGCAAGGCTTATAATCAAAAAAGTTGAAAGAAAGAATT
TT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC210320 protein sequence
Red=Cloning site Green=Tags(s)

MSVKGMAIALAVILCATVVQGFPMFKRGRCLCIGPGVKAVKVADIEKASIMYPSNNCDKIEVIITLKENK
GQRCLNPKSKQARLIIKKVERKNF

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_005409
ORF Size 282 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_005409.5
RefSeq Size 1610 bp
RefSeq ORF 285 bp
Locus ID 6373
UniProt ID O14625
Cytogenetics 4q21.1
Domains IL8
Protein Families Druggable Genome, Secreted Protein, Transmembrane
Protein Pathways Chemokine signaling pathway, Cytokine-cytokine receptor interaction, Toll-like receptor signaling pathway
MW 10.4 kDa
Summary Chemokines are a group of small (approximately 8 to 14 kD), mostly basic, structurally related molecules that regulate cell trafficking of various types of leukocytes through interactions with a subset of 7-transmembrane, G protein-coupled receptors. Chemokines also play fundamental roles in the development, homeostasis, and function of the immune system, and they have effects on cells of the central nervous system as well as on endothelial cells involved in angiogenesis or angiostasis. Chemokines are divided into 2 major subfamilies, CXC and CC. This antimicrobial gene is a CXC member of the chemokine superfamily. Its encoded protein induces a chemotactic response in activated T-cells and is the dominant ligand for CXC receptor-3. The gene encoding this protein contains 4 exons and at least three polyadenylation signals which might reflect cell-specific regulation of expression. IFN-gamma is a potent inducer of transcription of this gene. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2014]
Write Your Own Review
You're reviewing:CXCL11 (NM_005409) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC210320L1 Lenti ORF clone of Human chemokine (C-X-C motif) ligand 11 (CXCL11), Myc-DDK-tagged 10 ug
$450.00
RC210320L2 Lenti ORF clone of Human chemokine (C-X-C motif) ligand 11 (CXCL11), mGFP tagged 10 ug
$450.00
RC210320L3 Lenti ORF clone of Human chemokine (C-X-C motif) ligand 11 (CXCL11), Myc-DDK-tagged 10 ug
$450.00
RC210320L4 Lenti ORF clone of Human chemokine (C-X-C motif) ligand 11 (CXCL11), mGFP tagged 10 ug
$450.00
RG210320 CXCL11 (tGFP-tagged) - Human chemokine (C-X-C motif) ligand 11 (CXCL11) 10 ug
$489.00
SC116746 CXCL11 (untagged)-Human chemokine (C-X-C motif) ligand 11 (CXCL11) 10 ug
$150.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.