MYF5 (NM_005593) Human Tagged ORF Clone

SKU
RC210156
MYF5 (Myc-DDK-tagged)-Human myogenic factor 5 (MYF5)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol MYF5
Synonyms bHLHc2; EORVA
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC210156 representing NM_005593
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGACGTGATGGATGGCTGCCAGTTCTCACCTTCTGAGTACTTCTACGACGGCTCCTGCATACCGTCCC
CCGAGGGTGAATTTGGGGACGAGTTTGTGCCGCGAGTGGCTGCCTTCGGAGCGCACAAAGCAGAGCTGCA
GGGCTCAGATGAGGACGAGCACGTGCGAGCGCCTACCGGCCACCACCAGGCTGGTCACTGCCTCATGTGG
GCCTGCAAAGCCTGCAAGAGGAAGTCCACCACCATGGATCGGCGGAAGGCAGCCACTATGCGCGAGCGGA
GGCGCCTGAAGAAGGTCAACCAGGCTTTCGAAACCCTCAAGAGGTGTACCACGACCAACCCCAACCAGAG
GCTGCCCAAGGTGGAGATCCTCAGGAATGCCATCCGCTACATCGAGAGCCTGCAGGAGTTGCTGAGAGAG
CAGGTGGAGAACTACTATAGCCTGCCGGGACAGAGCTGCTCGGAGCCCACCAGCCCCACCTCCAACTGCT
CTGATGGCATGCCCGAATGTAACAGTCCTGTCTGGTCCAGAAAGAGCAGTACTTTTGACAGCATCTACTG
TCCTGATGTATCAAATGTATATGCCACAGATAAAAACTCCTTATCCAGCTTGGATTGCTTATCCAACATA
GTGGACCGGATCACCTCCTCAGAGCAACCTGGGTTGCCTCTCCAGGATCTGGCTTCTCTCTCTCCAGTTG
CCAGCACCGATTCACAGCCTGCAACTCCAGGGGCTTCTAGTTCCAGGCTTATCTATCATGTGCTA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC210156 representing NM_005593
Red=Cloning site Green=Tags(s)

MDVMDGCQFSPSEYFYDGSCIPSPEGEFGDEFVPRVAAFGAHKAELQGSDEDEHVRAPTGHHQAGHCLMW
ACKACKRKSTTMDRRKAATMRERRRLKKVNQAFETLKRCTTTNPNQRLPKVEILRNAIRYIESLQELLRE
QVENYYSLPGQSCSEPTSPTSNCSDGMPECNSPVWSRKSSTFDSIYCPDVSNVYATDKNSLSSLDCLSNI
VDRITSSEQPGLPLQDLASLSPVASTDSQPRTPGASSSRLIYHVL

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_005593
ORF Size 765 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_005593.3
RefSeq Size 1427 bp
RefSeq ORF 768 bp
Locus ID 4617
UniProt ID P13349
Cytogenetics 12q21.31
Domains Basic, HLH
Protein Families Druggable Genome, Transcription Factors
MW 28.1 kDa
Summary Transcriptional activator that promotes transcription of muscle-specific target genes and plays a role in muscle differentiation (PubMed:29887215). Together with MYOG and MYOD1, co-occupies muscle-specific gene promoter core region during myogenesis. Induces fibroblasts to differentiate into myoblasts. Probable sequence specific DNA-binding protein.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:MYF5 (NM_005593) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC210156L1 Lenti ORF clone of Human myogenic factor 5 (MYF5), Myc-DDK-tagged 10 ug
$600.00
RC210156L2 Lenti ORF clone of Human myogenic factor 5 (MYF5), mGFP tagged 10 ug
$600.00
RC210156L3 Lenti ORF clone of Human myogenic factor 5 (MYF5), Myc-DDK-tagged 10 ug
$600.00
RC210156L4 Lenti ORF clone of Human myogenic factor 5 (MYF5), mGFP tagged 10 ug
$600.00
RG210156 MYF5 (tGFP-tagged) - Human myogenic factor 5 (MYF5) 10 ug
$500.00
SC311244 MYF5 (untagged)-Human myogenic factor 5 (MYF5) 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.