Caspase 14 (CASP14) (NM_012114) Human Tagged ORF Clone

SKU
RC210146
CASP14 (Myc-DDK-tagged)-Human caspase 14, apoptosis-related cysteine peptidase (CASP14)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol Caspase 14
Synonyms ARCI12
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC210146 representing NM_012114
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAGCAATCCGCGGTCTTTGGAAGAGGAGAAATATGATATGTCAGGTGCCCGCCTGGCCCTAATACTGT
GTGTCACCAAAGCCCGGGAAGGTTCCGAAGAAGACCTGGATGCTCTGGAACACATGTTTCGGCAGCTGAG
ATTCGAAAGCACCATGAAAAGAGACCCCACTGCCGAGCAATTCCAGGAAGAGCTGGAAAAATTCCAGCAG
GCCATCGATTCCCGGGAAGATCCCGTCAGTTGTGCCTTCGTGGTACTCATGGCTCACGGGAGGGAAGGCT
TCCTCAAGGGAGAAGATGGGGAGATGGTCAAGCTGGAGAATCTCTTCGAGGCCCTGAACAACAAGAACTG
CCAGGCCCTGCGAGCTAAGCCCAAGGTGTACATCATACAGGCCTGTCGAGGAGAACAAAGGGACCCCGGT
GAAACAGTAGGTGGAGATGAGATTGTGATGGTCATCAAAGACAGCCCACAAACCATCCCAACATACACAG
ATGCCTTGCACGTTTATTCCACGGTAGAGGGATACATCGCCTACCGACATGATCAGAAAGGCTCATGCTT
TATCCAGACCCTGGTGGATGTGTTCACGAAGAGGAAAGGACATATCTTGGAACTTCTGACAGAGGTGACC
CGGCGGATGGCAGAAGCAGAGCTGGTTCAAGAAGGAAAAGCAAGGAAAACGAACCCTGAAATCCAAAGCA
CCCTCCGGAAACGGCTGTATCTGCAG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC210146 representing NM_012114
Red=Cloning site Green=Tags(s)

MSNPRSLEEEKYDMSGARLALILCVTKAREGSEEDLDALEHMFRQLRFESTMKRDPTAEQFQEELEKFQQ
AIDSREDPVSCAFVVLMAHGREGFLKGEDGEMVKLENLFEALNNKNCQALRAKPKVYIIQACRGEQRDPG
ETVGGDEIVMVIKDSPQTIPTYTDALHVYSTVEGYIAYRHDQKGSCFIQTLVDVFTKRKGHILELLTEVT
RRMAEAELVQEGKARKTNPEIQSTLRKRLYLQ

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_012114
ORF Size 726 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_012114.3
RefSeq Size 777 bp
RefSeq ORF 729 bp
Locus ID 23581
UniProt ID P31944
Cytogenetics 19p13.12
Protein Families Druggable Genome
MW 27.5 kDa
Summary This gene encodes a member of the cysteine-aspartic acid protease (caspase) family. Sequential activation of caspases plays a central role in the execution-phase of cell apoptosis. Caspases exist as inactive proenzymes which undergo proteolytic processing at conserved aspartic residues to produce two subunits, large and small, that dimerize to form the active enzyme. This caspase has been shown to be processed and activated by caspase 8 and caspase 10 in vitro, and by anti-Fas agonist antibody or TNF-related apoptosis inducing ligand in vivo. The expression and processing of this caspase may be involved in keratinocyte terminal differentiation, which is important for the formation of the skin barrier. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:Caspase 14 (CASP14) (NM_012114) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC210146L1 Lenti ORF clone of Human caspase 14, apoptosis-related cysteine peptidase (CASP14), Myc-DDK-tagged 10 ug
$600.00
RC210146L2 Lenti ORF clone of Human caspase 14, apoptosis-related cysteine peptidase (CASP14), mGFP tagged 10 ug
$600.00
RC210146L3 Lenti ORF clone of Human caspase 14, apoptosis-related cysteine peptidase (CASP14), Myc-DDK-tagged 10 ug
$600.00
RC210146L4 Lenti ORF clone of Human caspase 14, apoptosis-related cysteine peptidase (CASP14), mGFP tagged 10 ug
$600.00
RG210146 CASP14 (tGFP-tagged) - Human caspase 14, apoptosis-related cysteine peptidase (CASP14) 10 ug
$500.00
SC127955 CASP14 (untagged)-Human caspase 14, apoptosis-related cysteine peptidase (CASP14) 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.