Serotonin N acetyltransferase (AANAT) (NM_001088) Human Tagged ORF Clone
SKU
RC210142
AANAT (Myc-DDK-tagged)-Human aralkylamine N-acetyltransferase (AANAT), transcript variant 2
-
TrueORF Gold
Protein expression verified by Western blot, fully sequenced and in stock
Click here to learn more.
Product Data | |
Type | Human Tagged ORF Clone |
---|---|
Target Symbol | Serotonin N acetyltransferase |
Synonyms | DSPS; SNAT |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
ORF Nucleotide Sequence
>RC210142 representing NM_001088
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGTCCACGCAGAGCACCCACCCCCTGAAACCTGAGGCCCCACGTCTGCCACCTGGGATCCCCGAGTCCC CGAGCTGTCAGCGGCGCCACACACTCCCTGCCAGTGAGTTTCGCTGCCTCACCCCGGAGGACGCTGTCAG CGCCTTTGAGATCGAGCGTGAAGCCTTCATCTCCGTCTTGGGCGTCTGCCCCCTGTACCTGGATGAGATC CGGCACTTCCTGACCCTATGTCCAGAGCTGTCCCTGGGCTGGTTCGAGGAGGGCTGCCTTGTGGCCTTCA TCATCGGCTCGCTCTGGGACAAGGAGAGACTCATGCAGGAGTCACTGACGCTGCACAGGTCTGGGGGCCA CATAGCCCACCTGCATGTGCTGGCCGTGCACCGCGCCTTCCGGCAGCAGGGCAGGGGCCCCATCCTGCTG TGGCGCTACCTGCACCACCTGGGCAGCCAGCCGGCCGTGCGCCGGGCCGCGCTCATGTGCGAGGACGCGC TGGTACCCTTCTATGAGAGGTTCAGCTTCCACGCCGTGGGCCCCTGCGCCATCACCGTGGGCTCCCTCAC CTTCATGGAGCTCCACTGCTCCCTGCGGGGCCACCCCTTCCTGCGCAGGAACAGCGGCTGC ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>RC210142 representing NM_001088
Red=Cloning site Green=Tags(s) MSTQSTHPLKPEAPRLPPGIPESPSCQRRHTLPASEFRCLTPEDAVSAFEIEREAFISVLGVCPLYLDEI RHFLTLCPELSLGWFEEGCLVAFIIGSLWDKERLMQESLTLHRSGGHIAHLHVLAVHRAFRQQGRGPILL WRYLHHLGSQPAVRRAALMCEDALVPFYERFSFHAVGPCAITVGSLTFMELHCSLRGHPFLRRNSGC myc-FLAG tag |
Chromatograms |
Chromatograms
![]() Sequencher program is needed, download here |
Restriction Sites |
SgfI-MluI Cloning Scheme for this gene
Plasmid Map
![]() |
ACCN | NM_001088 |
ORF Size | 621 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution Method | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Note | Plasmids are not sterile. For experiments where strict sterility is required, filtration with 0.22um filter is required. |
Shipping | Ambient |
Reference Data | |
RefSeq | NM_001088.3 |
RefSeq Size | 1014 bp |
RefSeq ORF | 624 bp |
Locus ID | 15 |
UniProt ID | Q16613 |
Cytogenetics | 17q25.1 |
Protein Pathways | Metabolic pathways, Tryptophan metabolism |
MW | 23.2 kDa |
Summary | The protein encoded by this gene belongs to the acetyltransferase superfamily. It is the penultimate enzyme in melatonin synthesis and controls the night/day rhythm in melatonin production in the vertebrate pineal gland. Melatonin is essential for the function of the circadian clock that influences activity and sleep. This enzyme is regulated by cAMP-dependent phosphorylation that promotes its interaction with 14-3-3 proteins and thus protects the enzyme against proteasomal degradation. This gene may contribute to numerous genetic diseases such as delayed sleep phase syndrome. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2009] |
Write Your Own Review
Product Manuals |
FAQs |
SDS |
SKU | Description | Size | Price | |
---|---|---|---|---|
RC210142L1 | Lenti ORF clone of Human aralkylamine N-acetyltransferase (AANAT), transcript variant 2, Myc-DDK-tagged | 10 ug |
$600.00
|
|
RC210142L2 | Lenti ORF clone of Human aralkylamine N-acetyltransferase (AANAT), transcript variant 2, mGFP tagged | 10 ug |
$600.00
|
|
RC210142L3 | Lenti ORF clone of Human aralkylamine N-acetyltransferase (AANAT), transcript variant 2, Myc-DDK-tagged | 10 ug |
$600.00
|
|
RC210142L4 | Lenti ORF clone of Human aralkylamine N-acetyltransferase (AANAT), transcript variant 2, mGFP tagged | 10 ug |
$600.00
|
|
RG210142 | AANAT (tGFP-tagged) - Human aralkylamine N-acetyltransferase (AANAT), transcript variant 2 | 10 ug |
$500.00
|
|
SC302969 | AANAT (untagged)-Human aralkylamine N-acetyltransferase (AANAT), transcript variant 2 | 10 ug |
$300.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.