LIM2 (NM_030657) Human Tagged ORF Clone

SKU
RC210124
LIM2 (Myc-DDK-tagged)-Human lens intrinsic membrane protein 2, 19kDa (LIM2), transcript variant 1
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol LIM2
Synonyms CTRCT19; MP17; MP19
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC210124 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTACAGCTTCATGGGTGGTGGCCTGTTCTGTGCCTGGGTGGGGACCATCCTCCTGGTGGTGGCCATGG
CAACAGACCACTGGATGCAGTACCGGCTGTCAGGGTCCTTCGCCCACCAGGGCCTGTGGCGGTACTGCCT
GGGCAACAAGTGCTACCTGCAGACAGACAGCATCGGTGAGCCCCCCGGCCAGGGTCCAGGCCGCGCCTGG
GGAAAGAGCAGGGCGGACCTCGGGGCCCAAGGACACCTGTATTCCAGATGGAGAACTCTGCGGCTCAAAG
AGGGAAAGGGAGCAACCCAAGCATACTGGAATGCCACCCGGGCCTTCATGATCCTGTCTGCCCTATGCGC
CATCTCCGGCATCATCATGGGCATCATGGCCTTCGCTCATCAGCCTACCTTCTCCCGCATCTCCCGGCCC
TTCTCTGCTGGCATCATGTTTTTTTCCTCAACCCTTTTCGTCGTGTTGGCCTTGGCCATCTACACTGGAG
TCACCGTCAGCTTCCTGGGCCGCCGCTTTGGGGACTGGCGCTTTTCCTGGTCCTACATCCTGGGCTGGGT
GGCAGTGCTCATGACGTTCTTCGCAGGGATTTTCTACATGTGCGCCTACCGGGTGCATGAATGCCGGCGC
CTGTCTACACCCCGC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC210124 protein sequence
Red=Cloning site Green=Tags(s)

MYSFMGGGLFCAWVGTILLVVAMATDHWMQYRLSGSFAHQGLWRYCLGNKCYLQTDSIGEPPGQGPGRAW
GKSRADLGAQGHLYSRWRTLRLKEGKGATQAYWNATRAFMILSALCAISGIIMGIMAFAHQPTFSRISRP
FSAGIMFFSSTLFVVLALAIYTGVTVSFLGRRFGDWRFSWSYILGWVAVLMTFFAGIFYMCAYRVHECRR
LSTPR

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_030657
ORF Size 645 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_030657.4
RefSeq Size 1001 bp
RefSeq ORF 648 bp
Locus ID 3982
UniProt ID P55344
Cytogenetics 19q13.41
Protein Families Druggable Genome, Transmembrane
MW 24.2 kDa
Summary This gene encodes an eye lens-specific protein found at the junctions of lens fiber cells, where it may contribute to cell junctional organization. It acts as a receptor for calmodulin, and may play an important role in both lens development and cataractogenesis. Mutations in this gene have been associated with cataract formation. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.[provided by RefSeq, Sep 2009]
Write Your Own Review
You're reviewing:LIM2 (NM_030657) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC210124L3 Lenti ORF clone of Human lens intrinsic membrane protein 2, 19kDa (LIM2), transcript variant 1, Myc-DDK-tagged 10 ug
$600.00
RC210124L4 Lenti ORF clone of Human lens intrinsic membrane protein 2, 19kDa (LIM2), transcript variant 1, mGFP tagged 10 ug
$600.00
RG210124 LIM2 (tGFP-tagged) - Human lens intrinsic membrane protein 2, 19kDa (LIM2), transcript variant 1 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC305278 LIM2 (untagged)-Human lens intrinsic membrane protein 2, 19kDa (LIM2), transcript variant 1 10 ug
$330.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.