LAIR2 (NM_002288) Human Tagged ORF Clone

SKU
RC210108
LAIR2 (Myc-DDK-tagged)-Human leukocyte-associated immunoglobulin-like receptor 2 (LAIR2), transcript variant 1
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$225.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol LAIR2
Synonyms CD306
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC210108 representing NM_002288
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCTCCACACCTCACTGCTCTCCTGGGCCTAGTGCTCTGCCTGGCCCAGACCATCCACACGCAGGAGG
GGGCCCTTCCCAGACCCTCCATCTCGGCTGAGCCAGGCACTGTGATCTCCCCGGGGAGCCATGTGACTTT
CATGTGCCGGGGCCCGGTTGGGGTTCAAACATTCCGCCTGGAGAGGGAGGATAGAGCCAAGTACAAAGAT
AGTTATAATGTGTTTCGACTTGGTCCATCTGAGTCAGAGGCCAGATTCCACATTGACTCAGTAAGTGAAG
GAAATGCCGGGCTTTATCGCTGCCTCTATTATAAGCCCCCTGGATGGTCTGAGCACAGTGACTTCCTGGA
GCTGCTGGTGAAAGAAAGCTCTGGAGGCCCGGACTCCCCGGACACAGAGCCCGGCTCCTCAGCTGGGACT
GTGCCAGGCACTGAAGCCTCCGGATTTGATGCACCA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC210108 representing NM_002288
Red=Cloning site Green=Tags(s)

MSPHLTALLGLVLCLAQTIHTQEGALPRPSISAEPGTVISPGSHVTFMCRGPVGVQTFRLEREDRAKYKD
SYNVFRLGPSESEARFHIDSVSEGNAGLYRCLYYKPPGWSEHSDFLELLVKESSGGPDSPDTEPGSSAGT
VPGTEASGFDAP

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_002288
ORF Size 456 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_002288.6
RefSeq Size 702 bp
RefSeq ORF 459 bp
Locus ID 3904
UniProt ID Q6ISS4
Cytogenetics 19q13.42
Domains IG
Protein Families Secreted Protein
MW 16.7 kDa
Summary The protein encoded by this gene is a member of the immunoglobulin superfamily. It was identified by its similarity to leukocyte-associated immunoglobulin-like receptor 1, a membrane-bound receptor that modulates innate immune response. The protein encoded by this locus is a soluble receptor that may play roles in both inhibition of collagen-induced platelet aggregation and vessel formation during placental implantation. This gene maps to a region of 19q13.4, termed the leukocyte receptor cluster, which contains 29 genes in the immunoglobulin superfamily. Alternatively spliced transcript variants have been described for this gene. [provided by RefSeq, Sep 2013]
Write Your Own Review
You're reviewing:LAIR2 (NM_002288) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC210108L3 Lenti-ORF clone of LAIR2 (Myc-DDK-tagged)-Human leukocyte-associated immunoglobulin-like receptor 2 (LAIR2), transcript variant 1 10 ug
$525.00
RC210108L4 Lenti-ORF clone of LAIR2 (mGFP-tagged)-Human leukocyte-associated immunoglobulin-like receptor 2 (LAIR2), transcript variant 1 10 ug
$525.00
RG210108 LAIR2 (tGFP-tagged) - Human leukocyte-associated immunoglobulin-like receptor 2 (LAIR2), transcript variant 1 10 ug
$425.00
SC111649 LAIR2 (untagged)-Human leukocyte-associated immunoglobulin-like receptor 2 (LAIR2), transcript variant 1 10 ug
$450.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.