TSC22D3 (NM_004089) Human Tagged ORF Clone

SKU
RC210088
TSC22D3 (Myc-DDK-tagged)-Human TSC22 domain family, member 3 (TSC22D3), transcript variant 2
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$150.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol TSC22D3
Synonyms DIP; DSIPI; GILZ; TSC-22R
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC210088 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAACACCGAAATGTATCAGACCCCCATGGAGGTGGCGGTCTACCAGCTGCACAATTTCTCCATCTCCT
TCTTCTCTTCTCTGCTTGGAGGGGATGTGGTTTCCGTTAAGCTGGACAACAGTGCCTCCGGAGCCAGCGT
GGTGGCCATAGACAACAAGATCGAACAGGCCATGGATCTGGTGAAGAATCATCTGATGTATGCTGTGAGA
GAGGAGGTGGAGATCCTGAAGGAGCAGATCCGAGAGCTGGTGGAGAAGAACTCCCAGCTAGAGCGTGAGA
ACACCCTGTTGAAGACCCTGGCAAGCCCAGAGCAGCTGGAGAAGTTCCAGTCCTGTCTGAGCCCTGAAGA
GCCAGCTCCCGAATCCCCACAAGTGCCCGAGGCCCCTGGTGGTTCTGCGGTG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC210088 protein sequence
Red=Cloning site Green=Tags(s)

MNTEMYQTPMEVAVYQLHNFSISFFSSLLGGDVVSVKLDNSASGASVVAIDNKIEQAMDLVKNHLMYAVR
EEVEILKEQIRELVEKNSQLERENTLLKTLASPEQLEKFQSCLSPEEPAPESPQVPEAPGGSAV

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_004089
ORF Size 402 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_004089.4
RefSeq Size 1986 bp
RefSeq ORF 405 bp
Locus ID 1831
UniProt ID Q99576
Cytogenetics Xq22.3
Domains TSC22
Protein Families Transcription Factors
MW 14.8 kDa
Summary This gene encodes the anti-inflammatory protein glucocorticoid (GC)-induced leucine zipper. Expression of this gene stimulated by glucocorticoids and interleukin 10 and it appears to play a key role in the anti-inflammatory and immunosuppressive effects of this steroid. This protein has also been shown to inhibit pro-inflammatory molecules including nuclear factor κB. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Jan 2016]
Write Your Own Review
You're reviewing:TSC22D3 (NM_004089) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC210088L1 Lenti ORF clone of Human TSC22 domain family, member 3 (TSC22D3), transcript variant 2, Myc-DDK-tagged 10 ug
$450.00
RC210088L2 Lenti ORF clone of Human TSC22 domain family, member 3 (TSC22D3), transcript variant 2, mGFP tagged 10 ug
$450.00
RC210088L3 Lenti ORF clone of Human TSC22 domain family, member 3 (TSC22D3), transcript variant 2, Myc-DDK-tagged 10 ug
$450.00
RC210088L4 Lenti ORF clone of Human TSC22 domain family, member 3 (TSC22D3), transcript variant 2, mGFP tagged 10 ug
$450.00
RG210088 TSC22D3 (tGFP-tagged) - Human TSC22 domain family, member 3 (TSC22D3), transcript variant 2 10 ug
$489.00
SC127719 TSC22D3 (untagged)-Human TSC22 domain family, member 3 (TSC22D3), transcript variant 2 10 ug
$150.00
SC322024 TSC22D3 (untagged)-Human TSC22 domain family, member 3 (TSC22D3), transcript variant 2 10 ug
$150.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.