RAB1B (NM_030981) Human Tagged ORF Clone

SKU
RC209927
RAB1B (Myc-DDK-tagged)-Human RAB1B, member RAS oncogene family (RAB1B)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$300.00
5 Days*
Specifications
Product Data
Target Symbol RAB1B
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC209927 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAACCCCGAATATGACTACCTGTTTAAGCTGCTTTTGATTGGCGACTCAGGCGTGGGCAAGTCATGCC
TGCTCCTGCGGTTTGCTGATGACACGTACACAGAGAGCTACATCAGCACCATCGGGGTGGACTTCAAGAT
CCGAACCATCGAGCTGGATGGCAAAACTATCAAACTTCAGATCTGGGACACAGCGGGCCAGGAACGGTTC
CGGACCATCACTTCCAGCTACTACCGGGGGGCTCATGGCATCATCGTGGTGTATGACGTCACTGACCAGG
AATCCTACGCCAACGTGAAGCAGTGGCTGCAGGAGATTGACCGCTATGCCAGCGAGAACGTCAATAAGCT
CCTGGTGGGCAACAAGAGCGACCTCACCACCAAGAAGGTGGTGGACAACACCACAGCCAAGGAGTTTGCA
GACTCTCTGGGCATCCCCTTCTTGGAGACGAGCGCCAAGAATGCCACCAATGTCGAGCAGGCGTTCATGA
CCATGGCTGCTGAAATCAAAAAGCGGATGGGGCCTGGAGCAGCCTCTGGGGGCGAGCGGCCCAATCTCAA
GATCGACAGCACCCCTGTAAAGCCGGCTGGCGGTGGCTGTTGC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC209927 protein sequence
Red=Cloning site Green=Tags(s)

MNPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAGQERF
RTITSSYYRGAHGIIVVYDVTDQESYANVKQWLQEIDRYASENVNKLLVGNKSDLTTKKVVDNTTAKEFA
DSLGIPFLETSAKNATNVEQAFMTMAAEIKKRMGPGAASGGERPNLKIDSTPVKPAGGGCC

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_030981
ORF Size 603 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_030981.3
RefSeq Size 1955 bp
RefSeq ORF 606 bp
Locus ID 81876
UniProt ID Q9H0U4
Cytogenetics 11q13.2
Domains ARF, RAB, RAN, ras, RAS, RHO
Protein Families Transcription Factors
MW 22.2 kDa
Summary Members of the RAB protein family, such as RAB1B, are low molecular mass monomeric GTPases localized on the cytoplasmic surfaces of distinct membrane-bound organelles. RAB1B functions in the early secretory pathway and is essential for vesicle transport between the endoplasmic reticulum (ER) and Golgi (Chen et al., 1997 [PubMed 9030196]; Alvarez et al., 2003 [PubMed 12802079]).[supplied by OMIM, Jan 2009]
Write Your Own Review
You're reviewing:RAB1B (NM_030981) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC209927L1 Lenti ORF clone of Human RAB1B, member RAS oncogene family (RAB1B), Myc-DDK-tagged 10 ug
$600.00
RC209927L2 Lenti ORF clone of Human RAB1B, member RAS oncogene family (RAB1B), mGFP tagged 10 ug
$600.00
RC209927L3 Lenti ORF clone of Human RAB1B, member RAS oncogene family (RAB1B), Myc-DDK-tagged 10 ug
$600.00
RC209927L4 Lenti ORF clone of Human RAB1B, member RAS oncogene family (RAB1B), mGFP tagged 10 ug
$600.00
RG209927 RAB1B (tGFP-tagged) - Human RAB1B, member RAS oncogene family (RAB1B) 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC108613 RAB1B (untagged)-Human RAB1B, member RAS oncogene family (RAB1B) 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.