SURF1 (NM_003172) Human Tagged ORF Clone

SKU
RC209918
SURF1 (Myc-DDK-tagged)-Human surfeit 1 (SURF1), nuclear gene encoding mitochondrial protein
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol SURF1
Synonyms CMT4K; MC4DN1; SHY1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC209918 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGGCGGTGGCTGCGTTGCAGCTGGGGCTGCGGGCGGCGGGGCTGGGACGGGCCCCGGCCAGCGCCG
CCTGGAGGAGCGTCCTCAGGGTCTCCCCGCGCCCAGGGGTGGCCTGGAGGCCAAGCAGATGTGGCAGTTC
TGCAGCAGAAGCATCTGCCACAAAAGCGGAAGATGACTCCTTTCTTCAGTGGGTCCTGCTCCTCATCCCT
GTGACTGCCTTTGGCTTGGGGACATGGCAGGTCCAGCGTCGGAAGTGGAAGCTGAACCTGATTGCAGAGC
TGGAGTCCAGAGTTCTGGCTGAGCCTGTCCCTCTGCCAGCCGACCCAATGGAACTGAAAAATCTGGAGTA
TAGGCCAGTGAAGGTCAGGGGGTGCTTTGACCATTCCAAGGAGCTGTATATGATGCCCCGGACCATGGTG
GACCCTGTCCGGGAGGCCCGGGAGGGCGGCCTCATCTCCTCCTCAACTCAGAGTGGGGCCTATGTGGTCA
CTCCCTTCCACTGCACCGACCTGGGAGTCACCATCCTGGTAAATAGAGGGTTCGTTCCCAGGAAGAAAGT
GAATCCTGAAACGCGGCAGAAAGGCCAGATTGAGGGAGAAGTGGACCTCATTGGGATGGTGAGGCTGACA
GAAACCAGGCAGCCTTTTGTCCCTGAGAACAATCCAGAAAGGAACCACTGGCATTATCGAGACCTGGAAG
CTATGGCCAGAATCACAGGCGCAGAGCCCATCTTCATTGATGCCAACTTCCAGAGCACAGTCCCTGGAGG
ACCCATTGGAGGGCAAACCAGAGTTACTCTGAGGAACGAGCATCTGCAGTACATCGTGACCTGGTATGGA
CTCTCTGCAGCTACATCCTACCTGTGGTTTAAGAAATTCCTACGTGGGACACCTGGTGTG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC209918 protein sequence
Red=Cloning site Green=Tags(s)

MAAVAALQLGLRAAGLGRAPASAAWRSVLRVSPRPGVAWRPSRCGSSAAEASATKAEDDSFLQWVLLLIP
VTAFGLGTWQVQRRKWKLNLIAELESRVLAEPVPLPADPMELKNLEYRPVKVRGCFDHSKELYMMPRTMV
DPVREAREGGLISSSTQSGAYVVTPFHCTDLGVTILVNRGFVPRKKVNPETRQKGQIEGEVDLIGMVRLT
ETRQPFVPENNPERNHWHYRDLEAMARITGAEPIFIDANFQSTVPGGPIGGQTRVTLRNEHLQYIVTWYG
LSAATSYLWFKKFLRGTPGV

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_003172
ORF Size 900 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_003172.4
RefSeq Size 1046 bp
RefSeq ORF 903 bp
Locus ID 6834
UniProt ID Q15526
Cytogenetics 9q34.2
Domains SURF1
Protein Families Druggable Genome
MW 33.3 kDa
Summary This gene encodes a protein localized to the inner mitochondrial membrane and thought to be involved in the biogenesis of the cytochrome c oxidase complex. The protein is a member of the SURF1 family, which includes the related yeast protein SHY1 and rickettsial protein RP733. The gene is located in the surfeit gene cluster, a group of very tightly linked genes that do not share sequence similarity, where it shares a bidirectional promoter with SURF2 on the opposite strand. Defects in this gene are a cause of Leigh syndrome, a severe neurological disorder that is commonly associated with systemic cytochrome c oxidase deficiency. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:SURF1 (NM_003172) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC209918L1 Lenti ORF clone of Human surfeit 1 (SURF1), nuclear gene encoding mitochondrial protein, Myc-DDK-tagged 10 ug
$600.00
RC209918L2 Lenti ORF clone of Human surfeit 1 (SURF1), nuclear gene encoding mitochondrial protein, mGFP tagged 10 ug
$600.00
RC209918L3 Lenti ORF clone of Human surfeit 1 (SURF1), nuclear gene encoding mitochondrial protein, Myc-DDK-tagged 10 ug
$600.00
RC209918L4 Lenti ORF clone of Human surfeit 1 (SURF1), nuclear gene encoding mitochondrial protein, mGFP tagged 10 ug
$600.00
RG209918 SURF1 (tGFP-tagged) - Human surfeit 1 (SURF1), nuclear gene encoding mitochondrial protein 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC111028 SURF1 (untagged)-Human surfeit 1 (SURF1), nuclear gene encoding mitochondrial protein 10 ug
$300.00
SC322743 SURF1 (untagged)-Human surfeit 1 (SURF1), nuclear gene encoding mitochondrial protein 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.