MMD2 (NM_198403) Human Tagged ORF Clone

SKU
RC209898
MMD2 (Myc-DDK-tagged)-Human monocyte to macrophage differentiation-associated 2 (MMD2), transcript variant 2
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol MMD2
Synonyms PAQR10
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC209898 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTTCGCCCCCCGGCTGCTGGATTTCCAGAAGACGAAATACGCGAGGTTCATGAACCACCGAGTCCCTG
CCCACAAGAGGTACCAGCCCACAGAGTATGAACATGCGGCCAACTGTGCCACCCATGCTTTCTGGATCAT
CCCCAGCATCCTGGGCAGCTCCAACCTCTACTTCCTGTCGGACGATGACTGGGAGACCATCTCTGCCTGG
ATCTACGGCCTCGGCCTCTGCGGCCTCTTCGTGGTGTCCACTGTGTTTCACACCATCTCCTGGAAGAAGA
GCCACCTAAGGATGGTGGAACACTGTATACACATGTTCGACCGGATGGTCATCTATTTCTTCATAGCGGC
TTCCTACGCACCCTGGCTGAACCTTCGGGAGCTGGGCCCCTGGGCCTCCCACATGCGCTGGCTGGTCTGG
ATTATGGCTTCCGTGGGCACCATCTATGTCTTCTTCTTCCATGAGCGGTACAAGCTTGTGGAGCTTCTCT
GCTACGTCGTAATGGGCTTCTTCCCCGCCCTGGTCATCCTCTCCATGCCCAACACCGAGGGCATCTGGGA
GCTGGTGACCGGAGGGGTCTTCTACTGCCTGGGCATGGTCTTCTTCAAGAGTGACGGGAGGATCCCCTTT
GCCCACGCAATCTGGCATCTCTTTGTAGCATTTGGTGCTGGTACCCACTACTATGCCATCTGGAGGTACC
TCTATCTGCCCAGCACCCTGCAGACCAAGGTGTCCAAA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC209898 protein sequence
Red=Cloning site Green=Tags(s)

MFAPRLLDFQKTKYARFMNHRVPAHKRYQPTEYEHAANCATHAFWIIPSILGSSNLYFLSDDDWETISAW
IYGLGLCGLFVVSTVFHTISWKKSHLRMVEHCIHMFDRMVIYFFIAASYAPWLNLRELGPWASHMRWLVW
IMASVGTIYVFFFHERYKLVELLCYVVMGFFPALVILSMPNTEGIWELVTGGVFYCLGMVFFKSDGRIPF
AHAIWHLFVAFGAGTHYYAIWRYLYLPSTLQTKVSK

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_198403
ORF Size 738 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_198403.2, NP_940685.2
RefSeq Size 2362 bp
RefSeq ORF 741 bp
Locus ID 221938
UniProt ID Q8IY49
Cytogenetics 7p22.1
Protein Families Druggable Genome, Transmembrane
MW 28.8 kDa
Summary This gene encodes a member of the PAQR (progestin and adipoQ receptor) family. Members of this family are evolutionarily conserved with significant sequence identity to bacterial hemolysin-like proteins and are defined by a set of seven transmembrane domains. The protein encoded by this gene localizes to the Golgi apparatus to modulate Ras signaling. Alternative splicing results in multiple transcript variants and protein isoforms. [provided by RefSeq, Jun 2012]
Write Your Own Review
You're reviewing:MMD2 (NM_198403) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC209898L3 Lenti ORF clone of Human monocyte to macrophage differentiation-associated 2 (MMD2), transcript variant 2, Myc-DDK-tagged 10 ug
$600.00
RC209898L4 Lenti ORF clone of Human monocyte to macrophage differentiation-associated 2 (MMD2), transcript variant 2, mGFP tagged 10 ug
$600.00
RG209898 MMD2 (tGFP-tagged) - Human monocyte to macrophage differentiation-associated 2 (MMD2), transcript variant 2 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC307689 MMD2 (untagged)-Human monocyte to macrophage differentiation-associated 2 (MMD2), transcript variant 2 10 ug
$330.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.