Y14 (RBM8A) (NM_005105) Human Tagged ORF Clone

SKU
RC209770
RBM8A (Myc-DDK-tagged)-Human RNA binding motif protein 8A (RBM8A)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol Y14
Synonyms BOV-1A; BOV-1B; BOV-1C; C1DELq21.1; DEL1q21.1; MDS014; RBM8; RBM8B; TAR; Y14; ZNRP; ZRNP1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC209770 representing NM_005105
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGGACGTGCTAGATCTTCACGAGGCTGGGGGCGAAGATTTCGCCATGGATGAGGATGGGGACGAGA
GCATTCACAAACTGAAAGAAAAAGCGAAGAAACGGAAGGGTCGCGGCTTTGGCTCCGAAGAGGGGTCCCG
AGCGCGGATGCGTGAGGATTATGACAGCGTGGAGCAGGATGGCGATGAACCCGGACCACAACGCTCTGTT
GAAGGCTGGATTCTCTTTGTAACTGGAGTCCATGAGGAAGCCACCGAAGAAGACATACACGACAAATTCG
CAGAATATGGGGAAATTAAAAACATTCATCTCAACCTCGACAGGCGAACAGGATATCTGAAGGGGTATAC
TCTAGTTGAATATGAAACATACAAGGAAGCCCAGGCTGCTATGGAGGGACTCAATGGCCAGGATTTGATG
GGACAGCCCATCAGCGTTGACTGGTGTTTTGTTCGGGGTCCACCAAAAGGCAAGAGGAGAGGTGGCCGAA
GACGCAGCAGAAGTCCAGACCGGAGACGTCGC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC209770 representing NM_005105
Red=Cloning site Green=Tags(s)

MADVLDLHEAGGEDFAMDEDGDESIHKLKEKAKKRKGRGFGSEEGSRARMREDYDSVEQDGDEPGPQRSV
EGWILFVTGVHEEATEEDIHDKFAEYGEIKNIHLNLDRRTGYLKGYTLVEYETYKEAQAAMEGLNGQDLM
GQPISVDWCFVRGPPKGKRRGGRRRSRSPDRRRR

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_005105
ORF Size 522 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_005105.5
RefSeq Size 2787 bp
RefSeq ORF 525 bp
Locus ID 9939
UniProt ID Q9Y5S9
Cytogenetics 1q21.1
Domains RRM
Protein Families Druggable Genome
Protein Pathways Spliceosome
MW 19.7 kDa
Summary This gene encodes a protein with a conserved RNA-binding motif. The protein is found predominantly in the nucleus, although it is also present in the cytoplasm. It is preferentially associated with mRNAs produced by splicing, including both nuclear mRNAs and newly exported cytoplasmic mRNAs. It is thought that the protein remains associated with spliced mRNAs as a tag to indicate where introns had been present, thus coupling pre- and post-mRNA splicing events. Previously, it was thought that two genes encode this protein, RBM8A and RBM8B; it is now thought that the RBM8B locus is a pseudogene. There are two alternate translation start codons with this gene, which result in two forms of the protein. An allele mutation and a low-frequency noncoding single-nucleotide polymorphism (SNP) in this gene cause thrombocytopenia-absent radius (TAR) syndrome. [provided by RefSeq, Jul 2013]
Write Your Own Review
You're reviewing:Y14 (RBM8A) (NM_005105) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC209770L1 Lenti ORF clone of Human RNA binding motif protein 8A (RBM8A), Myc-DDK-tagged 10 ug
$600.00
RC209770L2 Lenti ORF clone of Human RNA binding motif protein 8A (RBM8A), mGFP tagged 10 ug
$600.00
RC209770L3 Lenti ORF clone of Human RNA binding motif protein 8A (RBM8A), Myc-DDK-tagged 10 ug
$600.00
RC209770L4 Lenti ORF clone of Human RNA binding motif protein 8A (RBM8A), mGFP tagged 10 ug
$600.00
RG209770 RBM8A (tGFP-tagged) - Human RNA binding motif protein 8A (RBM8A) 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC116929 RBM8A (untagged)-Human RNA binding motif protein 8A (RBM8A) 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.