Y14 (RBM8A) (NM_005105) Human Tagged ORF Clone
SKU
RC209770
RBM8A (Myc-DDK-tagged)-Human RNA binding motif protein 8A (RBM8A)
-
TrueORF Gold
Protein expression verified by Western blot, fully sequenced and in stock
Click here to learn more.
Product Data | |
Type | Human Tagged ORF Clone |
---|---|
Target Symbol | Y14 |
Synonyms | BOV-1A; BOV-1B; BOV-1C; C1DELq21.1; DEL1q21.1; MDS014; RBM8; RBM8B; TAR; Y14; ZNRP; ZRNP1 |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
ORF Nucleotide Sequence
>RC209770 representing NM_005105
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGGCGGACGTGCTAGATCTTCACGAGGCTGGGGGCGAAGATTTCGCCATGGATGAGGATGGGGACGAGA GCATTCACAAACTGAAAGAAAAAGCGAAGAAACGGAAGGGTCGCGGCTTTGGCTCCGAAGAGGGGTCCCG AGCGCGGATGCGTGAGGATTATGACAGCGTGGAGCAGGATGGCGATGAACCCGGACCACAACGCTCTGTT GAAGGCTGGATTCTCTTTGTAACTGGAGTCCATGAGGAAGCCACCGAAGAAGACATACACGACAAATTCG CAGAATATGGGGAAATTAAAAACATTCATCTCAACCTCGACAGGCGAACAGGATATCTGAAGGGGTATAC TCTAGTTGAATATGAAACATACAAGGAAGCCCAGGCTGCTATGGAGGGACTCAATGGCCAGGATTTGATG GGACAGCCCATCAGCGTTGACTGGTGTTTTGTTCGGGGTCCACCAAAAGGCAAGAGGAGAGGTGGCCGAA GACGCAGCAGAAGTCCAGACCGGAGACGTCGC ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>RC209770 representing NM_005105
Red=Cloning site Green=Tags(s) MADVLDLHEAGGEDFAMDEDGDESIHKLKEKAKKRKGRGFGSEEGSRARMREDYDSVEQDGDEPGPQRSV EGWILFVTGVHEEATEEDIHDKFAEYGEIKNIHLNLDRRTGYLKGYTLVEYETYKEAQAAMEGLNGQDLM GQPISVDWCFVRGPPKGKRRGGRRRSRSPDRRRR myc-FLAG tag |
Chromatograms |
Chromatograms
![]() Sequencher program is needed, download here |
Restriction Sites |
SgfI-MluI Cloning Scheme for this gene
Plasmid Map
![]() |
ACCN | NM_005105 |
ORF Size | 522 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution Method | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Note | Plasmids are not sterile. For experiments where strict sterility is required, filtration with 0.22um filter is required. |
Shipping | Ambient |
Reference Data | |
RefSeq | NM_005105.5 |
RefSeq Size | 2787 bp |
RefSeq ORF | 525 bp |
Locus ID | 9939 |
UniProt ID | Q9Y5S9 |
Cytogenetics | 1q21.1 |
Domains | RRM |
Protein Families | Druggable Genome |
Protein Pathways | Spliceosome |
MW | 19.7 kDa |
Summary | This gene encodes a protein with a conserved RNA-binding motif. The protein is found predominantly in the nucleus, although it is also present in the cytoplasm. It is preferentially associated with mRNAs produced by splicing, including both nuclear mRNAs and newly exported cytoplasmic mRNAs. It is thought that the protein remains associated with spliced mRNAs as a tag to indicate where introns had been present, thus coupling pre- and post-mRNA splicing events. Previously, it was thought that two genes encode this protein, RBM8A and RBM8B; it is now thought that the RBM8B locus is a pseudogene. There are two alternate translation start codons with this gene, which result in two forms of the protein. An allele mutation and a low-frequency noncoding single-nucleotide polymorphism (SNP) in this gene cause thrombocytopenia-absent radius (TAR) syndrome. [provided by RefSeq, Jul 2013] |
Write Your Own Review
Product Manuals |
FAQs |
SDS |
SKU | Description | Size | Price | |
---|---|---|---|---|
RC209770L1 | Lenti ORF clone of Human RNA binding motif protein 8A (RBM8A), Myc-DDK-tagged | 10 ug |
$600.00
|
|
RC209770L2 | Lenti ORF clone of Human RNA binding motif protein 8A (RBM8A), mGFP tagged | 10 ug |
$600.00
|
|
RC209770L3 | Lenti ORF clone of Human RNA binding motif protein 8A (RBM8A), Myc-DDK-tagged | 10 ug |
$600.00
|
|
RC209770L4 | Lenti ORF clone of Human RNA binding motif protein 8A (RBM8A), mGFP tagged | 10 ug |
$600.00
|
|
RG209770 | RBM8A (tGFP-tagged) - Human RNA binding motif protein 8A (RBM8A) | 10 ug |
$489.00
MSRP
$500.00
MSRP
$500.00
|
|
SC116929 | RBM8A (untagged)-Human RNA binding motif protein 8A (RBM8A) | 10 ug |
$300.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.