LYZL2 (NM_183058) Human Tagged ORF Clone

SKU
RC209699
LYZL2 (Myc-DDK-tagged)-Human lysozyme-like 2 (LYZL2)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$289.00 MSRP $300.00 MSRP $300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol LYZL2
Synonyms LYZD2
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC209699 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCAGGACGCTCCCCTGAGCTGCCTGTCACCGACTAAGTGGAGCAGTGTTTCTTCCGCAGACTCAACTG
AGAAGTCAGCCTCTGCGGCAGGCACCAGGAATCTGCCTTTTCAGTTCTGTCTCCGGCAGGCTTTGAGGAT
GAAGGCTGCGGGCATTCTGACCCTCATTGGCTGCCTGGTCACAGGCGCCGAGTCCAAAATCTACACTCGT
TGCAAACTGGCAAAAATATTCTCGAGGGCTGGCCTGGACAATTACTGGGGCTTCAGCCTTGGAAACTGGA
TCTGCATGGCGTATTATGAGAGCGGCTACAACACCACAGCCCAGACGGTCCTGGATGACGGCAGCATCGA
CTACGGCATCTTCCAGATCAACAGCTTCGCGTGGTGCAGACGCGGAAAGCTGAAGGAGAACAACCACTGC
CACGTCGCCTGCTCAGCCTTGGTCACTGATGACCTCACAGATGCGATTATCTGTGCCAAGAAAATTGTTA
AAGAGACACAAGGAATGAATTATTGGCAAGGCTGGAAGAAACACTGTGAGGGGAGAGACCTGTCCGACTG
GAAAAAAGACTGTGAGGTTTCC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC209699 protein sequence
Red=Cloning site Green=Tags(s)

MQDAPLSCLSPTKWSSVSSADSTEKSASAAGTRNLPFQFCLRQALRMKAAGILTLIGCLVTGAESKIYTR
CKLAKIFSRAGLDNYWGFSLGNWICMAYYESGYNTTAQTVLDDGSIDYGIFQINSFAWCRRGKLKENNHC
HVACSALVTDDLTDAIICAKKIVKETQGMNYWQGWKKHCEGRDLSDWKKDCEVS

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_183058
ORF Size 582 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq Size 777 bp
RefSeq ORF 447 bp
Locus ID 119180
UniProt ID Q7Z4W2
Cytogenetics 10p11.23
Protein Families Secreted Protein
MW 21.6 kDa
Summary Lysozymes (see LYZ; MIM 153450), especially C-type lysozymes, are well-recognized bacteriolytic factors widely distributed in the animal kingdom and play a mainly protective role in host defense. LYZL2 is a member of a family of lysozyme-like genes (Zhang et al., 2005 [PubMed 16014814]).[supplied by OMIM, Apr 2009]
Write Your Own Review
You're reviewing:LYZL2 (NM_183058) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC209699L3 Lenti-ORF clone of LYZL2 (Myc-DDK-tagged)-Human lysozyme-like 2 (LYZL2) 10 ug
$600.00
RC209699L4 Lenti-ORF clone of LYZL2 (mGFP-tagged)-Human lysozyme-like 2 (LYZL2) 10 ug
$600.00
RG209699 LYZL2 (tGFP-tagged) - Human lysozyme-like 2 (LYZL2) 10 ug
$500.00
SC125973 LYZL2 (untagged)-Human lysozyme-like 2 (LYZL2) 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.