ARP10 (APOBEC3H) (NM_181773) Human Tagged ORF Clone

SKU
RC209663
APOBEC3H (Myc-DDK-tagged)-Human apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3H (APOBEC3H), transcript variant 2
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$702.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol ARP10
Synonyms A3H; ARP-10; ARP10
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC209663 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCTCTGTTAACAGCCGAAACATTCCGCTTACAGTTTAACAACAAGCGCCGCCTCAGAAGGCCTTACT
ACCCGAGGAAGGCCCTCTTGTGTTACCAGCTGACGCCGCAGAATGGCTCCACGCCCACGAGAGGCTACTT
TGAAAACAAGAAAAAGTGCCATGCAGAAATTTGCTTTATTAACGAGATCAAGTCCATGGGACTGGACGAA
ACGCAGTGCTACCAAGTCACCTGTTACCTCACGTGGAGCCCCTGCTCCTCCTGTGCCTGGGAGCTGGTTG
ACTTCATCAAGGCTCACGACCATCTGAACCTGGGCATCTTCGCCTCCCGCCTGTACTACCACTGGTGCAA
GCCCCAGCAGAAGGGGCTGCGGCTTCTGTGTGGATCCCAGGTCCCGGTGGAGGTCATGGGCTTCCCAGAG
TTTGCTGACTGCTGGGAAAACTTTGTGGACCACGAGAAACCGCTTTCCTTCAACCCCTATAAGATGTTAG
AGGAGCTAGATAAAAACAGTCGAGCCATAAAGCGACGGCTTGAGAGGATAAAGTCC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC209663 protein sequence
Red=Cloning site Green=Tags(s)

MALLTAETFRLQFNNKRRLRRPYYPRKALLCYQLTPQNGSTPTRGYFENKKKCHAEICFINEIKSMGLDE
TQCYQVTCYLTWSPCSSCAWELVDFIKAHDHLNLGIFASRLYYHWCKPQQKGLRLLCGSQVPVEVMGFPE
FADCWENFVDHEKPLSFNPYKMLEELDKNSRAIKRRLERIKS

myc-FLAG tag
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_181773
ORF Size 546 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_181773.5
RefSeq Size 1070 bp
RefSeq ORF 552 bp
Locus ID 164668
UniProt ID Q6NTF7
Cytogenetics 22q13.1
MW 21.5 kDa
Summary This gene encodes a member of the apolipoprotein B mRNA-editing enzyme catalytic polypeptide 3 family of proteins. The encoded protein is a cytidine deaminase that has antiretroviral activity by generating lethal hypermutations in viral genomes. Polymorphisms and alternative splicing in this gene influence its antiretroviral activity and are associated with increased resistence to human immunodeficiency virus type 1 infection in certain populations. Alternative splicing results in multiple transcript variants.[provided by RefSeq, Oct 2009]
Write Your Own Review
You're reviewing:ARP10 (APOBEC3H) (NM_181773) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC209663L3 Lenti-ORF clone of APOBEC3H (Myc-DDK-tagged)-Human apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3H (APOBEC3H), transcript variant 2 10 ug
$1,002.00
RC209663L4 Lenti-ORF clone of APOBEC3H (mGFP-tagged)-Human apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3H (APOBEC3H), transcript variant 2 10 ug
$1,002.00
RG209663 APOBEC3H (tGFP-tagged) - Human apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3H (APOBEC3H), transcript variant 2 10 ug
$902.00
SC319818 APOBEC3H (untagged)-Human apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3H (APOBEC3H), transcript variant 2 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.