CD90 (THY1) (NM_006288) Human Tagged ORF Clone

SKU
RC209458
THY1 (Myc-DDK-tagged)-Human Thy-1 cell surface antigen (THY1)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$289.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol CD90
Synonyms CD90; CDw90
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC209458 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAACCTGGCCATCAGCATCGCTCTCCTGCTAACAGTCTTGCAGGTCTCCCGAGGGCAGAAGGTGACCA
GCCTAACGGCCTGCCTAGTGGACCAGAGCCTTCGTCTGGACTGCCGCCATGAGAATACCAGCAGTTCACC
CATCCAGTACGAGTTCAGCCTGACCCGTGAGACAAAGAAGCACGTGCTCTTTGGCACTGTGGGGGTGCCT
GAGCACACATACCGCTCCCGAACCAACTTCACCAGCAAATACAACATGAAGGTCCTCTACTTATCCGCCT
TCACTAGCAAGGACGAGGGCACCTACACGTGTGCACTCCACCACTCTGGCCATTCCCCACCCATCTCCTC
CCAGAACGTCACAGTGCTCAGAGACAAACTGGTCAAGTGTGAGGGCATCAGCCTGCTGGCTCAGAACACC
TCGTGGCTGCTGCTGCTCCTGCTCTCCCTCTCCCTCCTCCAGGCCACGGATTTCATGTCCCTG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC209458 protein sequence
Red=Cloning site Green=Tags(s)

MNLAISIALLLTVLQVSRGQKVTSLTACLVDQSLRLDCRHENTSSSPIQYEFSLTRETKKHVLFGTVGVP
EHTYRSRTNFTSKYNMKVLYLSAFTSKDEGTYTCALHHSGHSPPISSQNVTVLRDKLVKCEGISLLAQNT
SWLLLLLLSLSLLQATDFMSL

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_006288
ORF Size 483 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_006288.5
RefSeq Size 2413 bp
RefSeq ORF 486 bp
Locus ID 7070
UniProt ID P04216
Cytogenetics 11q23.3
Domains ig, IGv
Protein Families ES Cell Differentiation/IPS
Protein Pathways Leukocyte transendothelial migration
MW 17.9 kDa
Summary This gene encodes a cell surface glycoprotein and member of the immunoglobulin superfamily of proteins. The encoded protein is involved in cell adhesion and cell communication in numerous cell types, but particularly in cells of the immune and nervous systems. The encoded protein is widely used as a marker for hematopoietic stem cells. This gene may function as a tumor suppressor in nasopharyngeal carcinoma. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2015]
Write Your Own Review
You're reviewing:CD90 (THY1) (NM_006288) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC209458L1 Lenti ORF clone of Human Thy-1 cell surface antigen (THY1), Myc-DDK-tagged 10 ug
$450.00
RC209458L2 Lenti ORF clone of Human Thy-1 cell surface antigen (THY1), mGFP tagged 10 ug
$450.00
RC209458L3 Lenti ORF clone of Human Thy-1 cell surface antigen (THY1), Myc-DDK-tagged 10 ug
$450.00
RC209458L4 Lenti ORF clone of Human Thy-1 cell surface antigen (THY1), mGFP tagged 10 ug
$450.00
RG209458 THY1 (tGFP-tagged) - Human Thy-1 cell surface antigen (THY1) 10 ug
$489.00
SC127532 THY1 (untagged)-Human Thy-1 cell surface antigen (THY1) 10 ug
$150.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.