Uroplakin Ib (UPK1B) (NM_006952) Human Tagged ORF Clone

SKU
RC209443
UPK1B (Myc-DDK-tagged)-Human uroplakin 1B (UPK1B)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$289.00 MSRP $300.00 MSRP $300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol Uroplakin Ib
Synonyms TSPAN20; UPIB; UPK1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC209443 representing NM_006952
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCCAAAGACAACTCAACTGTTCGTTGCTTCCAGGGCCTGCTGATTTTTGGAAATGTGATTATTGGTT
GTTGCGGCATTGCCCTGACTGCGGAGTGCATCTTCTTTGTATCTGACCAACACAGCCTCTACCCACTGCT
TGAAGCCACCGACAACGATGACATCTATGGGGCTGCCTGGATCGGCATATTTGTGGGCATCTGCCTCTTC
TGCCTGTCTGTTCTAGGCATTGTAGGCATCATGAAGTCCAGCAGGAAAATTCTTCTGGCGTATTTCATTC
TGATGTTTATAGTATATGCCTTTGAAGTGGCATCTTGTATCACAGCAGCAACACAACGAGACTTTTTCAC
ACCCAACCTCTTCCTGAAGCAGATGCTAGAGAGGTACCAAAACAACAGCCCTCCAAACAATGATGACCAG
TGGAAAAACAATGGAGTCACCAAAACCTGGGACAGGCTCATGCTCCAGGACAATTGCTGTGGCGTAAATG
GTCCATCAGACTGGCAAAAATACACATCTGCCTTCCGGACTGAGAATAATGATGCTGACTATCCCTGGCC
TCGTCAATGCTGTGTTATGAACAATCTTAAAGAACCTCTCAACCTGGAGGCTTGTAAACTAGGCGTGCCT
GGTTTTTATCACAATCAGGGCTGCTATGAACTGATCTCTGGTCCAATGAACCGACACGCCTGGGGGGTTG
CCTGGTTTGGATTTGCCATTCTCTGCTGGACTTTTTGGGTTCTCCTGGGTACCATGTTCTACTGGAGCAG
AATTGAATAT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC209443 representing NM_006952
Red=Cloning site Green=Tags(s)

MAKDNSTVRCFQGLLIFGNVIIGCCGIALTAECIFFVSDQHSLYPLLEATDNDDIYGAAWIGIFVGICLF
CLSVLGIVGIMKSSRKILLAYFILMFIVYAFEVASCITAATQRDFFTPNLFLKQMLERYQNNSPPNNDDQ
WKNNGVTKTWDRLMLQDNCCGVNGPSDWQKYTSAFRTENNDADYPWPRQCCVMNNLKEPLNLEACKLGVP
GFYHNQGCYELISGPMNRHAWGVAWFGFAILCWTFWVLLGTMFYWSRIEY

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_006952
ORF Size 780 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_006952.2
RefSeq Size 2060 bp
RefSeq ORF 783 bp
Locus ID 7348
UniProt ID O75841
Cytogenetics 3q13.32
Protein Families Transmembrane
MW 29.5 kDa
Summary The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. This encoded protein is found in the asymmetrical unit membrane (AUM) where it can form a complex with other transmembrane 4 superfamily proteins. It may play a role in normal bladder epithelial physiology, possibly in regulating membrane permeability of superficial umbrella cells or in stabilizing the apical membrane through AUM/cytoskeletal interactions. The use of alternate polyadenylation sites has been found for this gene. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:Uroplakin Ib (UPK1B) (NM_006952) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC209443L1 Lenti ORF clone of Human uroplakin 1B (UPK1B), Myc-DDK-tagged 10 ug
$600.00
RC209443L2 Lenti ORF clone of Human uroplakin 1B (UPK1B), mGFP tagged 10 ug
$600.00
RC209443L3 Lenti ORF clone of Human uroplakin 1B (UPK1B), Myc-DDK-tagged 10 ug
$600.00
RC209443L4 Lenti ORF clone of Human uroplakin 1B (UPK1B), mGFP tagged 10 ug
$600.00
RG209443 UPK1B (tGFP-tagged) - Human uroplakin 1B (UPK1B) 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC122765 UPK1B (untagged)-Human uroplakin 1B (UPK1B) 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.