PSMB5 (NM_002797) Human Tagged ORF Clone

SKU
RC209326
PSMB5 (Myc-DDK-tagged)-Human proteasome (prosome, macropain) subunit, beta type, 5 (PSMB5), transcript variant 1
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol PSMB5
Synonyms LMPX; MB1; X
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC209326 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGCTTGCCAGCGTGTTGGAGAGACCGCTACCGGTGAACCAGCGCGGGTTTTTCGGACTTGGGGGTC
GTGCAGATCTGCTGGATCTAGGTCCAGGGAGTCTCAGTGATGGTCTGAGCCTGGCCGCGCCAGGCTGGGG
TGTCCCAGAAGAGCCAGGAATCGAAATGCTTCATGGAACAACCACCCTGGCCTTCAAGTTCCGCCATGGA
GTCATAGTTGCAGCTGACTCCAGGGCTACAGCGGGTGCTTACATTGCCTCCCAGACGGTGAAGAAGGTGA
TAGAGATCAACCCATACCTGCTTGGCACCATGGCTGGGGGCGCAGCGGATTGCAGCTTCTGGGAACGGCT
GTTGGCTCGGCAATGTCGAATCTATGAGCTTCGAAATAAGGAACGCATCTCTGTAGCAGCTGCCTCCAAA
CTGCTTGCCAACATGGTGTATCAGTACAAAGGCATGGGGCTGTCCATGGGCACCATGATCTGTGGCTGGG
ATAAGAGAGGCCCTGGCCTCTACTACGTGGACAGTGAAGGGAACCGGATTTCAGGGGCCACCTTCTCTGT
AGGTTCTGGCTCTGTGTATGCATATGGGGTCATGGATCGGGGCTATTCCTATGACCTGGAAGTGGAGCAG
GCCTATGATCTGGCCCGTCGAGCCATCTACCAAGCCACCTACAGAGATGCCTACTCAGGAGGTGCAGTCA
ACCTCTACCACGTGCGGGAGGATGGCTGGATCCGAGTCTCCAGTGACAATGTGGCTGATCTACATGAGAA
GTATAGTGGCTCTACCCCC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC209326 protein sequence
Red=Cloning site Green=Tags(s)

MALASVLERPLPVNQRGFFGLGGRADLLDLGPGSLSDGLSLAAPGWGVPEEPGIEMLHGTTTLAFKFRHG
VIVAADSRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAASK
LLANMVYQYKGMGLSMGTMICGWDKRGPGLYYVDSEGNRISGATFSVGSGSVYAYGVMDRGYSYDLEVEQ
AYDLARRAIYQATYRDAYSGGAVNLYHVREDGWIRVSSDNVADLHEKYSGSTP

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_002797
ORF Size 789 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_002797.5
RefSeq Size 1311 bp
RefSeq ORF 792 bp
Locus ID 5693
UniProt ID P28074
Cytogenetics 14q11.2
Domains proteasome
Protein Families Protease
Protein Pathways Proteasome
MW 28.5 kDa
Summary The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a member of the proteasome B-type family, also known as the T1B family, that is a 20S core beta subunit in the proteasome. This catalytic subunit is not present in the immunoproteasome and is replaced by catalytic subunit 3i (proteasome beta 8 subunit). Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jan 2009]
 
 
 
 
 
Be the first to review this product
SKU Description Size Price
RC209326L1 Lenti ORF clone of Human proteasome (prosome, macropain) subunit, beta type, 5 (PSMB5), transcript variant 1, Myc-DDK-tagged 10 ug
$600.00
RC209326L2 Lenti ORF clone of Human proteasome (prosome, macropain) subunit, beta type, 5 (PSMB5), transcript variant 1, mGFP tagged 10 ug
$600.00
RC209326L3 Lenti ORF clone of Human proteasome (prosome, macropain) subunit, beta type, 5 (PSMB5), transcript variant 1, Myc-DDK-tagged 10 ug
$600.00
RC209326L4 Lenti ORF clone of Human proteasome (prosome, macropain) subunit, beta type, 5 (PSMB5), transcript variant 1, mGFP tagged 10 ug
$600.00
RG209326 PSMB5 (tGFP-tagged) - Human proteasome (prosome, macropain) subunit, beta type, 5 (PSMB5), transcript variant 1 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC320115 PSMB5 (untagged)-Human proteasome (prosome, macropain) subunit, beta type, 5 (PSMB5), transcript variant 1 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.