ELOVL2 (NM_017770) Human Tagged ORF Clone

SKU
RC209232
ELOVL2 (Myc-DDK-tagged)-Human ELOVL fatty acid elongase 2 (ELOVL2)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$289.00 MSRP $300.00 MSRP $300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol ELOVL2
Synonyms SSC2
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC209232 representing NM_017770
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAACATCTAAAGGCCTTTGATGATGAAATCAATGCTTTTTTGGACAATATGTTTGGACCGCGAGATT
CTCGAGTCAGAGGGTGGTTCATGTTGGACTCTTACCTTCCTACCTTTTTTCTTACTGTCATGTATCTGCT
CTCAATATGGCTGGGTAACAAGTATATGAAGAACAGACCTGCTCTTTCTCTCAGGGGTATCCTCACCTTG
TATAATCTTGGAATCACACTTCTCTCCGCGTACATGCTGGCAGAGCTCATTCTCTCCACTTGGGAAGGAG
GCTACAACTTACAGTGTCAAGATCTTACCAGCGCAGGGGAAGCTGACATCCGGGTAGCCAAGGTGCTTTG
GTGGTACTATTTCTCCAAATCAGTAGAGTTCCTGGACACAATTTTCTTCGTTTTGCGGAAAAAAACGAGT
CAGATTACTTTTCTTCATGTATATCATCATGCTTCTATGTTTAACATCTGGTGGTGTGTCTTGAACTGGA
TACCTTGTGGACAAAGTTTCTTTGGACCAACACTGAACAGTTTTATCCACATTCTTATGTACTCCTACTA
TGGACTTTCTGTGTTTCCATCTATGCACAAGTATCTTTGGTGGAAGAAATATCTCACACAGGCTCAGCTG
GTGCAGTTCGTGCTCACCATCACGCACACCATGAGCGCCGTCGTGAAACCGTGTGGCTTCCCCTTCGGTT
GTCTCATCTTCCAGTCATCTTATATGCTAACGTTAGTCATCCTCTTCTTAAATTTTTACGTTCAGACATA
CCGAAAAAAGCCAATGAAGAAAGATATGCAAGAGCCACCTGCAGGGAAAGAAGTGAAGAATGGTTTTTCC
AAAGCCTACTTCACTGCAGCAAATGGAGTGATGAACAAGAAAGCACAA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC209232 representing NM_017770
Red=Cloning site Green=Tags(s)

MEHLKAFDDEINAFLDNMFGPRDSRVRGWFMLDSYLPTFFLTVMYLLSIWLGNKYMKNRPALSLRGILTL
YNLGITLLSAYMLAELILSTWEGGYNLQCQDLTSAGEADIRVAKVLWWYYFSKSVEFLDTIFFVLRKKTS
QITFLHVYHHASMFNIWWCVLNWIPCGQSFFGPTLNSFIHILMYSYYGLSVFPSMHKYLWWKKYLTQAQL
VQFVLTITHTMSAVVKPCGFPFGCLIFQSSYMLTLVILFLNFYVQTYRKKPMKKDMQEPPAGKEVKNGFS
KAYFTAANGVMNKKAQ

myc-FLAG tag
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_017770
ORF Size 888 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_017770.2, NP_060240.2
RefSeq Size 4079 bp
RefSeq ORF 891 bp
Locus ID 54898
UniProt ID Q9NXB9
Cytogenetics 6p24.2
Domains ELO
Protein Families Transmembrane
Protein Pathways Biosynthesis of unsaturated fatty acids
MW 34.6 kDa
Summary Catalyzes the first and rate-limiting reaction of the four reactions that constitute the long-chain fatty acids elongation cycle. This endoplasmic reticulum-bound enzymatic process allows the addition of 2 carbons to the chain of long- and very long-chain fatty acids (VLCFAs) per cycle. Condensing enzyme that catalyzes the synthesis of polyunsaturated very long chain fatty acid (C20- and C22-PUFA), acting specifically toward polyunsaturated acyl-CoA with the higher activity toward C20:4(n-6) acyl-CoA. May participate in the production of polyunsaturated VLCFAs of different chain lengths that are involved in multiple biological processes as precursors of membrane lipids and lipid mediators.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:ELOVL2 (NM_017770) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC209232L1 Lenti ORF clone of Human ELOVL fatty acid elongase 2 (ELOVL2), Myc-DDK-tagged 10 ug
$600.00
RC209232L2 Lenti ORF clone of Human ELOVL fatty acid elongase 2 (ELOVL2), mGFP tagged 10 ug
$600.00
RC209232L3 Lenti ORF clone of Human ELOVL fatty acid elongase 2 (ELOVL2), Myc-DDK-tagged 10 ug
$600.00
RC209232L4 Lenti ORF clone of Human ELOVL fatty acid elongase 2 (ELOVL2), mGFP tagged 10 ug
$600.00
RG209232 ELOVL2 (tGFP-tagged) - Human ELOVL fatty acid elongase 2 (ELOVL2) 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC113934 ELOVL2 (untagged)-Human ELOVL fatty acid elongase 2 (ELOVL2) 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.