Unrip (STRAP) (NM_007178) Human Tagged ORF Clone

SKU
RC209149
STRAP (Myc-DDK-tagged)-Human serine/threonine kinase receptor associated protein (STRAP)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$686.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol Unrip
Synonyms MAWD; PT-WD; UNRIP
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC209149 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCAATGAGACAGACGCCGCTCACCTGCTCTGGCCACACGCGACCCGTGGTTGATTTGGCCTTCAGTG
GCATCACGCCTTATGGGTATTTCTTAATCAGCGCTTGCAAAGATGGTAAACCTATGCTACGCCAGGGAGA
TACAGGAGACTGGATTGGAACATTTTTGGGTCATAAAGGTGCTGTTTGGGGTGCAACACTGAATAAGGAT
GCCACCAAAGCAGCTACAGCAGCTGCAGATTTCACAGCCAAAGTGTGGGATGCTGTCTCAGGAGATGAAT
TGATGACCCTGGCTCATAAACACATTGTCAAGACTGTGGATTTCACGCAGGATAGTAATTATTTGTTAAC
CGGGGGACAGGATAAACTGTTACGCATATATGACTTGAACAAACCTGAAGCAGAACCTAAGGAAATTAGT
GGTCATACTTCTGGTATAAAAAAAGCTCTGTGGTGCAGTGAGGATAAACAGATTCTTTCTGCTGATGACA
AAACTGTTCGACTTTGGGATCATGCTACTATGACAGAAGTGAAATCTCTAAATTTTAATATGTCTGTTAG
TAGTATGGAATATATTCCTGAGGGAGAGATTTTGGTTATAACTTATGGACGATCTATTGCTTTTCATAGT
GCAGTAAGTTTGGACCCAATTAAATCCTTTGAAGCTCCTGCAACCATCAATTCTGCATCTCTTCATCCTG
AGAAAGAATTTCTTGTTGCAGGCGGTGAAGATTTTAAACTTTATAAGTATGATTATAATAGTGGAGAAGA
ATTAGAATCCTACAAGGGACACTTTGGTCCTATTCACTGTGTGAGATTTAGTCCTGATGGAGAACTCTAT
GCCAGTGGTTCAGAAGATGGAACATTGAGACTATGGCAAACTGTGGTAGGAAAAACGTATGGCCTTTGGA
AATGTGTGCTTCCTGAAGAAGATAGTGGTGAGCTGGCAAAGCCAAAGATTGGTTTTCCAGAGACAACAGA
AGAGGAGCTAGAAGAAATTGCTTCAGAGAATTCAGATTGCATCTTTCCTTCAGCTCCTGATGTTAAGGCC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC209149 protein sequence
Red=Cloning site Green=Tags(s)

MAMRQTPLTCSGHTRPVVDLAFSGITPYGYFLISACKDGKPMLRQGDTGDWIGTFLGHKGAVWGATLNKD
ATKAATAAADFTAKVWDAVSGDELMTLAHKHIVKTVDFTQDSNYLLTGGQDKLLRIYDLNKPEAEPKEIS
GHTSGIKKALWCSEDKQILSADDKTVRLWDHATMTEVKSLNFNMSVSSMEYIPEGEILVITYGRSIAFHS
AVSLDPIKSFEAPATINSASLHPEKEFLVAGGEDFKLYKYDYNSGEELESYKGHFGPIHCVRFSPDGELY
ASGSEDGTLRLWQTVVGKTYGLWKCVLPEEDSGELAKPKIGFPETTEEELEEIASENSDCIFPSAPDVKA

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_007178
ORF Size 1050 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_007178.4
RefSeq Size 1924 bp
RefSeq ORF 1053 bp
Locus ID 11171
UniProt ID Q9Y3F4
Cytogenetics 12p12.3
Domains WD40
Protein Families Druggable Genome
MW 38.4 kDa
Summary The SMN complex plays a catalyst role in the assembly of small nuclear ribonucleoproteins (snRNPs), the building blocks of the spliceosome. Thereby, plays an important role in the splicing of cellular pre-mRNAs. Most spliceosomal snRNPs contain a common set of Sm proteins SNRPB, SNRPD1, SNRPD2, SNRPD3, SNRPE, SNRPF and SNRPG that assemble in a heptameric protein ring on the Sm site of the small nuclear RNA to form the core snRNP. In the cytosol, the Sm proteins SNRPD1, SNRPD2, SNRPE, SNRPF and SNRPG are trapped in an inactive 6S pICln-Sm complex by the chaperone CLNS1A that controls the assembly of the core snRNP. Dissociation by the SMN complex of CLNS1A from the trapped Sm proteins and their transfer to an SMN-Sm complex triggers the assembly of core snRNPs and their transport to the nucleus. STRAP plays a role in the cellular distribution of the SMN complex. Negatively regulates TGF-beta signaling but positively regulates the PDPK1 kinase activity by enhancing its autophosphorylation and by significantly reducing the association of PDPK1 with 14-3-3 protein.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:Unrip (STRAP) (NM_007178) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC209149L1 Lenti ORF clone of Human serine/threonine kinase receptor associated protein (STRAP), Myc-DDK-tagged 10 ug
$986.00
RC209149L2 Lenti ORF clone of Human serine/threonine kinase receptor associated protein (STRAP), mGFP tagged 10 ug
$986.00
RC209149L3 Lenti ORF clone of Human serine/threonine kinase receptor associated protein (STRAP), Myc-DDK-tagged 10 ug
$986.00
RC209149L4 Lenti ORF clone of Human serine/threonine kinase receptor associated protein (STRAP), mGFP tagged 10 ug
$986.00
RG209149 STRAP (tGFP-tagged) - Human serine/threonine kinase receptor associated protein (STRAP) 10 ug
$886.00
SC115667 STRAP (untagged)-Human serine/threonine kinase receptor associated protein (STRAP) 10 ug
$457.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.