Phosphoserine phosphatase (PSPH) (NM_004577) Human Tagged ORF Clone

SKU
RC209090
PSPH (Myc-DDK-tagged)-Human phosphoserine phosphatase (PSPH)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol Phosphoserine phosphatase
Synonyms PSP; PSPHD
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC209090 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGTCTCCCACTCAGAGCTGAGGAAGCTTTTCTACTCAGCAGATGCTGTGTGTTTTGATGTTGACAGCA
CGGTCATCAGAGAAGAAGGAATCGATGAGCTAGCCAAAATCTGTGGCGTTGAGGACGCGGTGTCAGAAAT
GACACGGCGAGCCATGGGCGGGGCAGTGCCTTTCAAAGCTGCTCTCACAGAGCGCTTAGCCCTCATCCAG
CCCTCCAGGGAGCAGGTGCAGAGACTCATAGCAGAGCAACCCCCACACCTGACCCCCGGCATAAGGGAGC
TGGTAAGTCGCCTACAGGAGCGAAATGTTCAGGTTTTCCTAATATCTGGTGGCTTTAGGAGTATTGTAGA
GCATGTTGCTTCAAAGCTCAATATCCCAGCAACCAATGTATTTGCCAATAGGCTGAAATTCTACTTTAAC
GGTGAATATGCAGGTTTTGATGAGACGCAGCCAACAGCTGAATCTGGTGGAAAAGGAAAAGTGATTAAAC
TTTTAAAGGAAAAATTTCATTTTAAGAAAATAATCATGATTGGAGATGGTGCCACAGATATGGAAGCCTG
TCCTCCTGCTGATGCTTTCATTGGATTTGGAGGAAATGTGATCAGGCAACAAGTCAAGGATAACGCCAAA
TGGTATATCACTGATTTTGTAGAGCTGCTGGGAGAACTGGAAGAA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC209090 protein sequence
Red=Cloning site Green=Tags(s)

MVSHSELRKLFYSADAVCFDVDSTVIREEGIDELAKICGVEDAVSEMTRRAMGGAVPFKAALTERLALIQ
PSREQVQRLIAEQPPHLTPGIRELVSRLQERNVQVFLISGGFRSIVEHVASKLNIPATNVFANRLKFYFN
GEYAGFDETQPTAESGGKGKVIKLLKEKFHFKKIIMIGDGATDMEACPPADAFIGFGGNVIRQQVKDNAK
WYITDFVELLGELEE

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_004577
ORF Size 675 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_004577.4
RefSeq Size 2142 bp
RefSeq ORF 678 bp
Locus ID 5723
UniProt ID P78330
Cytogenetics 7p11.2
Protein Families Druggable Genome, Phosphatase
Protein Pathways Glycine, Metabolic pathways, serine and threonine metabolism
MW 25 kDa
Summary The protein encoded by this gene belongs to a subfamily of the phosphotransferases. This encoded enzyme is responsible for the third and last step in L-serine formation. It catalyzes magnesium-dependent hydrolysis of L-phosphoserine and is also involved in an exchange reaction between L-serine and L-phosphoserine. Deficiency of this protein is thought to be linked to Williams syndrome. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:Phosphoserine phosphatase (PSPH) (NM_004577) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC209090L1 Lenti ORF clone of Human phosphoserine phosphatase (PSPH), Myc-DDK-tagged 10 ug
$600.00
RC209090L2 Lenti ORF clone of Human phosphoserine phosphatase (PSPH), mGFP tagged 10 ug
$600.00
RC209090L3 Lenti ORF clone of Human phosphoserine phosphatase (PSPH), Myc-DDK-tagged 10 ug
$600.00
RC209090L4 Lenti ORF clone of Human phosphoserine phosphatase (PSPH), mGFP tagged 10 ug
$600.00
RG209090 PSPH (tGFP-tagged) - Human phosphoserine phosphatase (PSPH) 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC128000 PSPH (untagged)-Human phosphoserine phosphatase (PSPH) 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.