ICOS Ligand (ICOSLG) (NM_015259) Human Tagged ORF Clone

SKU
RC208975
ICOSLG (Myc-DDK-tagged)-Human inducible T-cell co-stimulator ligand (ICOSLG)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$289.00 MSRP $450.00 MSRP $450.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol ICOS Ligand
Synonyms B7-H2; B7h; B7H2; B7RP-1; B7RP1; CD275; GL50; ICOS-L; ICOSL; LICOS
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC208975 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCGGCTGGGCAGTCCTGGACTGCTCTTCCTGCTCTTCAGCAGCCTTCGAGCTGATACTCAGGAGAAGG
AAGTCAGAGCGATGGTAGGCAGCGACGTGGAGCTCAGCTGCGCTTGCCCTGAAGGAAGCCGTTTTGATTT
AAATGATGTTTACGTATATTGGCAAACCAGTGAGTCGAAAACCGTGGTGACCTACCACATCCCACAGAAC
AGCTCCTTGGAAAACGTGGACAGCCGCTACCGGAACCGAGCCCTGATGTCACCGGCCGGCATGCTGCGGG
GCGACTTCTCCCTGCGCTTGTTCAACGTCACCCCCCAGGACGAGCAGAAGTTTCACTGCCTGGTGTTGAG
CCAATCCCTGGGATTCCAGGAGGTTTTGAGCGTTGAGGTTACACTGCATGTGGCAGCAAACTTCAGCGTG
CCCGTCGTCAGCGCCCCCCACAGCCCCTCCCAGGATGAGCTCACCTTCACGTGTACATCCATAAACGGCT
ACCCCAGGCCCAACGTGTACTGGATCAATAAGACGGACAACAGCCTGCTGGACCAGGCTCTGCAGAATGA
CACCGTCTTCTTGAACATGCGGGGCTTGTATGACGTGGTCAGCGTGCTGAGGATCGCACGGACCCCCAGC
GTGAACATTGGCTGCTGCATAGAGAACGTGCTTCTGCAGCAGAACCTGACTGTCGGCAGCCAGACAGGAA
ATGACATCGGAGAGAGAGACAAGATCACAGAGAATCCAGTCAGTACCGGCGAGAAAAACGCGGCCACGTG
GAGCATCCTGGCTGTCCTGTGCCTGCTTGTGGTCGTGGCGGTGGCCATAGGCTGGGTGTGCAGGGACCGA
TGCCTCCAACACAGCTATGCAGGTGCCTGGGCTGTGAGTCCGGAGACAGAGCTCACTGGCCACGTT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC208975 protein sequence
Red=Cloning site Green=Tags(s)

MRLGSPGLLFLLFSSLRADTQEKEVRAMVGSDVELSCACPEGSRFDLNDVYVYWQTSESKTVVTYHIPQN
SSLENVDSRYRNRALMSPAGMLRGDFSLRLFNVTPQDEQKFHCLVLSQSLGFQEVLSVEVTLHVAANFSV
PVVSAPHSPSQDELTFTCTSINGYPRPNVYWINKTDNSLLDQALQNDTVFLNMRGLYDVVSVLRIARTPS
VNIGCCIENVLLQQNLTVGSQTGNDIGERDKITENPVSTGEKNAATWSILAVLCLLVVVAVAIGWVCRDR
CLQHSYAGAWAVSPETELTGHV

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_015259
ORF Size 906 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_015259.6
RefSeq Size 3320 bp
RefSeq ORF 909 bp
Locus ID 23308
UniProt ID O75144
Cytogenetics 21q22.3
Protein Families Transmembrane
Protein Pathways Cell adhesion molecules (CAMs)
MW 33.3 kDa
Summary Ligand for the T-cell-specific cell surface receptor ICOS. Acts as a costimulatory signal for T-cell proliferation and cytokine secretion; induces also B-cell proliferation and differentiation into plasma cells. Could play an important role in mediating local tissue responses to inflammatory conditions, as well as in modulating the secondary immune response by co-stimulating memory T-cell function (By similarity).[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:ICOS Ligand (ICOSLG) (NM_015259) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC208975L1 Lenti ORF clone of Human inducible T-cell co-stimulator ligand (ICOSLG), Myc-DDK-tagged 10 ug
$750.00
RC208975L2 Lenti ORF clone of Human inducible T-cell co-stimulator ligand (ICOSLG), mGFP tagged 10 ug
$750.00
RC208975L3 Lenti ORF clone of Human inducible T-cell co-stimulator ligand (ICOSLG), Myc-DDK-tagged 10 ug
$750.00
RC208975L4 Lenti ORF clone of Human inducible T-cell co-stimulator ligand (ICOSLG), mGFP tagged 10 ug
$750.00
RG208975 ICOSLG (tGFP-tagged) - Human inducible T-cell co-stimulator ligand (ICOSLG) 10 ug
$489.00 MSRP $650.00 MSRP $650.00
SC309183 ICOSLG (untagged)-Human inducible T-cell co-stimulator ligand (ICOSLG) 10 ug
$450.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.