VCY (VCY1B) (NM_181880) Human Tagged ORF Clone
SKU
RC208868
VCY1B (Myc-DDK-tagged)-Human variable charge, Y-linked 1B (VCY1B)
-
TrueORF®
TrueORF®
Expression-ready ORF plasmid with C-terminal tag(s)
Click here to learn more.
Product Data | |
Type | Human Tagged ORF Clone |
---|---|
Target Symbol | VCY |
Synonyms | BPY1B |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
ORF Nucleotide Sequence
>RC208868 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGAGTCCAAAGCCGAGAGCCTCGGGACCTCCGGCCAAGGCCAAGGAGACAGGAAAGAGGAAGTCCTCCT CTCAGCCGAGCCCCAGTGGCCCGAAGAAGAAGACTACCAAGGTGGCCGAGAAGGGAGAAGCAGTTCGTGG AGGGAGACGCGGGAAGAAAGGGGCTGCGACAAAGATGGCGGCCGTGACGGCACCTGAGGCGGAGAGCGGG CCAGCGGCACCCGGCCCCAGCGACCAGCCCAGCCAGGAGCTCCCTCAGCACGAGCTGCCGCCGGAGGAGC CAGTGAGCGAGGGGACCCAGCACGACCCCCTGAGTCAGGAGAGCGAGCTGGAGGAACCACTGAGTAAGGG GCGCCCATCTACTCCCCTATCTCCC ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>RC208868 protein sequence
Red=Cloning site Green=Tags(s) MSPKPRASGPPAKAKETGKRKSSSQPSPSGPKKKTTKVAEKGEAVRGGRRGKKGAATKMAAVTAPEAESG PAAPGPSDQPSQELPQHELPPEEPVSEGTQHDPLSQESELEEPLSKGRPSTPLSP myc-FLAG tag |
Restriction Sites |
SgfI-MluI Cloning Scheme for this gene
Plasmid Map
![]() |
ACCN | NM_181880 |
ORF Size | 375 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution Method | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Note | Plasmids are not sterile. For experiments where strict sterility is required, filtration with 0.22um filter is required. |
Shipping | Ambient |
Reference Data | |
RefSeq | NM_181880.2 |
RefSeq Size | 573 bp |
RefSeq ORF | 378 bp |
Locus ID | 353513 |
UniProt ID | O14598 |
Cytogenetics | Yq11.221 |
MW | 12.9 kDa |
Summary | The protein encoded by this gene is a member of a family of human VCX/Y genes. This gene family has multiple members on both X and Y chromosomes, and all are expressed exclusively in male germ cells. Members of the VCX/Y family share a high degree of sequence identity, with the exception that a 30-bp unit is tandemly repeated in X-linked members but occurs only once in Y-linked members. VCX/Y genes encode small and highly charged proteins of unknown function. This gene encodes a small, positively charged protein. The presence of a putative bipartite nuclear localization signal suggests that this gene encodes a nuclear protein. The genome has two identical copies of this gene within a palindromic region; this record represents the more telomeric copy. [provided by RefSeq, Jul 2008] |
Write Your Own Review
Product Manuals |
FAQs |
SDS |
SKU | Description | Size | Price | |
---|---|---|---|---|
RC208868L3 | Lenti-ORF clone of VCY1B (Myc-DDK-tagged)-Human variable charge, Y-linked 1B (VCY1B) | 10 ug |
$450.00
|
|
RC208868L4 | Lenti-ORF clone of VCY1B (mGFP-tagged)-Human variable charge, Y-linked 1B (VCY1B) | 10 ug |
$450.00
|
|
RG208868 | VCY1B (tGFP-tagged) - Human variable charge, Y-linked 1B (VCY1B) | 10 ug |
$350.00
|
|
SC125625 | VCY1B (untagged)-Human variable charge, Y-linked 1B (VCY1B) | 10 ug |
$150.00
|
|
SC320986 | VCY1B (untagged)-Human variable charge, Y-linked 1B (VCY1B) | 10 ug |
$150.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.