OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

HOXC9 (NM_006897) Human Tagged ORF Clone

  • Product Brand Image
Be the first to review this product
SKU
RC208833
HOXC9 (Myc-DDK-tagged)-Human homeobox C9 (HOXC9)
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
  $300.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (5)

TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "HOXC9 or NM_006897"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol HOXC9
Synonyms HOX3; HOX3B
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC208833 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCGGCGACGGGGCCCATCAGTAACTATTACGTGGACTCGCTCATCTCTCACGACAATGAAGACCTCC
TAGCGTCCAGGTTTCCGGCCACCGGGGCTCATCCCGCCGCCGCCAGACCCAGCGGTTTGGTGCCGGACTG
TAGCGATTTTCCGTCCTGTAGCTTCGCGCCCAAGCCGGCAGTGTTCAGCACGTCGTGGGCGCCCGTGCCC
TCTCAGTCGTCCGTGGTATATCACCCGTACGGCCCCCAGCCCCACCTCGGCGCCGACACGCGCTACATGC
GGACTTGGCTCGAGCCGCTGTCCGGCGCCGTCTCCTTCCCCAGCTTCCCGGCCGGGGGCCGTCACTACGC
CCTCAAGCCGGACGCCTACCCCGGGCGCCGCGCGGACTGCGGCCCAGGGGAGGGCCGCAGCTACCCGGAC
TACATGTACGGCTCGCCCGGGGAGCTGCGCGACCGCGCCCCGCAGACACTGCCCTCGCCCGAGGCGGACG
CGCTCGCCGGCAGCAAGCACAAAGAGGAGAAGGCTGACCTGGACCCCAGCAACCCCGTGGCCAACTGGAT
TCACGCCCGCTCCACGAGGAAGAAGCGCTGCCCCTACACCAAGTACCAGACGCTGGAACTGGAGAAGGAG
TTTCTCTTCAATATGTATTTAACCAGGGACCGTCGGTATGAGGTGGCCCGGGTTCTCAATCTCACCGAGC
GGCAGGTCAAAATCTGGTTTCAGAATCGAAGGATGAAGATGAAAAAGATGAATAAAGAGAAAACCGACAA
GGAGCAGTCC

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>RC208833 protein sequence
Red=Cloning site Green=Tags(s)

MSATGPISNYYVDSLISHDNEDLLASRFPATGAHPAAARPSGLVPDCSDFPSCSFAPKPAVFSTSWAPVP
SQSSVVYHPYGPQPHLGADTRYMRTWLEPLSGAVSFPSFPAGGRHYALKPDAYPGRRADCGPGEGRSYPD
YMYGSPGELRDRAPQTLPSPEADALAGSKHKEEKADLDPSNPVANWIHARSTRKKRCPYTKYQTLELEKE
FLFNMYLTRDRRYEVARVLNLTERQVKIWFQNRRMKMKKMNKEKTDKEQS

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_006897
ORF Size 780 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_006897.3
RefSeq Size 1640 bp
RefSeq ORF 783 bp
Locus ID 3225
UniProt ID P31274
Cytogenetics 12q13.13
Protein Families Transcription Factors
MW 29.2 kDa
Summary This gene belongs to the homeobox family of genes. The homeobox genes encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene clusters, HOXA, HOXB, HOXC and HOXD, which are located on different chromosomes and consist of 9 to 11 genes arranged in tandem. This gene is one of several homeobox HOXC genes located in a cluster on chromosome 12. provided by RefSeq, Jul 2008
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_006897" in other vectors (4)
SKU Description Size Price
RC208833L3 Lenti ORF clone of Human homeobox C9 (HOXC9), Myc-DDK-tagged 10 ug
$600.00
RC208833L4 Lenti ORF clone of Human homeobox C9 (HOXC9), mGFP tagged 10 ug
$600.00
RG208833 HOXC9 (tGFP-tagged) - Human homeobox C9 (HOXC9) 10 ug
$500.00
SC125818 HOXC9 (untagged)-Human homeobox C9 (HOXC9) 10 ug
$300.00

Plasmid Map for RC208833

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for RC208833
Circular map for RC208833

file-alt Citations

HOXC9 Induces Phenotypic Switching between Proliferation and Invasion in Breast Cancer Cells
Hur, Lee, Yang et al
J Cancer (2016) 7 (7), 768-73 DOI: 10.7150/jca.13894
Cited by 38
AI Summary: OriGene products contributed to this study by providing the HOXC9 cDNA clone (RC210334) for overexpression experiments and HOXC9-specific siRNA (SR321731) for gene knockdown, enabling the authors to investigate the effects of HOXC9 on breast cancer cell proliferation and invasion.
FigureFigureFigure
HOXC9 Induces Phenotypic Switching between Proliferation and Invasion in Breast Cancer Cells
Hur, Lee, Yang et al
Journal of Cancer (2016) 7 (7), 768-773
AI Summary: OriGene's pCMV6 expression vector containing full-length HOXC9 cDNA (#RC208833) was used to overexpress HOXC9 in MDA-MB-231 breast cancer cells, enabling the study of its role in phenotypic switching between proliferation and invasion.
Snippet: For overexpression studies, a pCMV6 expression vector containing full-length cDNA of the HOXC9 gene and Myc-DDK-tag (#RC208833;Origene, Rockville, MD, USA) was transfected in MDA-MB-231 cells using Attractene reagent (Qiagen). ... Cite SaveSaving
Showing 1-2 of 2 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products