HOXC9 (NM_006897) Human Tagged ORF Clone

SKU
RC208833
HOXC9 (Myc-DDK-tagged)-Human homeobox C9 (HOXC9)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol HOXC9
Synonyms HOX3; HOX3B
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC208833 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCGGCGACGGGGCCCATCAGTAACTATTACGTGGACTCGCTCATCTCTCACGACAATGAAGACCTCC
TAGCGTCCAGGTTTCCGGCCACCGGGGCTCATCCCGCCGCCGCCAGACCCAGCGGTTTGGTGCCGGACTG
TAGCGATTTTCCGTCCTGTAGCTTCGCGCCCAAGCCGGCAGTGTTCAGCACGTCGTGGGCGCCCGTGCCC
TCTCAGTCGTCCGTGGTATATCACCCGTACGGCCCCCAGCCCCACCTCGGCGCCGACACGCGCTACATGC
GGACTTGGCTCGAGCCGCTGTCCGGCGCCGTCTCCTTCCCCAGCTTCCCGGCCGGGGGCCGTCACTACGC
CCTCAAGCCGGACGCCTACCCCGGGCGCCGCGCGGACTGCGGCCCAGGGGAGGGCCGCAGCTACCCGGAC
TACATGTACGGCTCGCCCGGGGAGCTGCGCGACCGCGCCCCGCAGACACTGCCCTCGCCCGAGGCGGACG
CGCTCGCCGGCAGCAAGCACAAAGAGGAGAAGGCTGACCTGGACCCCAGCAACCCCGTGGCCAACTGGAT
TCACGCCCGCTCCACGAGGAAGAAGCGCTGCCCCTACACCAAGTACCAGACGCTGGAACTGGAGAAGGAG
TTTCTCTTCAATATGTATTTAACCAGGGACCGTCGGTATGAGGTGGCCCGGGTTCTCAATCTCACCGAGC
GGCAGGTCAAAATCTGGTTTCAGAATCGAAGGATGAAGATGAAAAAGATGAATAAAGAGAAAACCGACAA
GGAGCAGTCC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC208833 protein sequence
Red=Cloning site Green=Tags(s)

MSATGPISNYYVDSLISHDNEDLLASRFPATGAHPAAARPSGLVPDCSDFPSCSFAPKPAVFSTSWAPVP
SQSSVVYHPYGPQPHLGADTRYMRTWLEPLSGAVSFPSFPAGGRHYALKPDAYPGRRADCGPGEGRSYPD
YMYGSPGELRDRAPQTLPSPEADALAGSKHKEEKADLDPSNPVANWIHARSTRKKRCPYTKYQTLELEKE
FLFNMYLTRDRRYEVARVLNLTERQVKIWFQNRRMKMKKMNKEKTDKEQS

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_006897
ORF Size 780 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_006897.3
RefSeq Size 1640 bp
RefSeq ORF 783 bp
Locus ID 3225
UniProt ID P31274
Cytogenetics 12q13.13
Protein Families Transcription Factors
MW 29.2 kDa
Summary This gene belongs to the homeobox family of genes. The homeobox genes encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene clusters, HOXA, HOXB, HOXC and HOXD, which are located on different chromosomes and consist of 9 to 11 genes arranged in tandem. This gene is one of several homeobox HOXC genes located in a cluster on chromosome 12. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:HOXC9 (NM_006897) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC208833L3 Lenti ORF clone of Human homeobox C9 (HOXC9), Myc-DDK-tagged 10 ug
$600.00
RC208833L4 Lenti ORF clone of Human homeobox C9 (HOXC9), mGFP tagged 10 ug
$600.00
RG208833 HOXC9 (tGFP-tagged) - Human homeobox C9 (HOXC9) 10 ug
$500.00
SC125818 HOXC9 (untagged)-Human homeobox C9 (HOXC9) 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.