Galectin 3 (LGALS3) (NM_002306) Human Tagged ORF Clone

SKU
RC208785
LGALS3 (Myc-DDK-tagged)-Human lectin, galactoside-binding, soluble, 3 (LGALS3), transcript variant 1
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Target Symbol Galectin 3
Synonyms CBP35; GAL3; GALBP; GALIG; L31; LGALS2; MAC2
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC208785 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCAGACAATTTTTCGCTCCATGATGCGTTATCTGGGTCTGGAAACCCAAACCCTCAAGGATGGCCTG
GCGCATGGGGGAACCAGCCTGCTGGGGCAGGGGGCTACCCAGGGGCTTCCTATCCTGGGGCCTACCCCGG
GCAGGCACCCCCAGGGGCTTATCCTGGACAGGCACCTCCAGGCGCCTACCATGGAGCACCTGGAGCTTAT
CCCGGAGCACCTGCACCTGGAGTCTACCCAGGGCCACCCAGCGGCCCTGGGGCCTACCCATCTTCTGGAC
AGCCAAGTGCCCCCGGAGCCTACCCTGCCACTGGCCCCTATGGCGCCCCTGCTGGGCCACTGATTGTGCC
TTATAACCTGCCTTTGCCTGGGGGAGTGGTGCCTCGCATGCTGATAACAATTCTGGGCACGGTGAAGCCC
AATGCAAACAGAATTGCTTTAGATTTCCAAAGAGGGAATGATGTTGCCTTCCACTTTAACCCACGCTTCA
ATGAGAACAACAGGAGAGTCATTGTTTGCAATACAAAGCTGGATAATAACTGGGGAAGGGAAGAAAGACA
GTCGGTTTTCCCATTTGAAAGTGGGAAACCATTCAAAATACAAGTACTGGTTGAACCTGACCACTTCAAG
GTTGCAGTGAATGATGCTCACTTGTTGCAGTACAATCATCGGGTTAAAAAACTCAATGAAATCAGCAAAC
TGGGAATTTCTGGTGACATAGACCTCACCAGTGCTTCATATACCATGATA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC208785 protein sequence
Red=Cloning site Green=Tags(s)

MADNFSLHDALSGSGNPNPQGWPGAWGNQPAGAGGYPGASYPGAYPGQAPPGAYPGQAPPGAYHGAPGAY
PGAPAPGVYPGPPSGPGAYPSSGQPSAPGAYPATGPYGAPAGPLIVPYNLPLPGGVVPRMLITILGTVKP
NANRIALDFQRGNDVAFHFNPRFNENNRRVIVCNTKLDNNWGREERQSVFPFESGKPFKIQVLVEPDHFK
VAVNDAHLLQYNHRVKKLNEISKLGISGDIDLTSASYTMI

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_002306
ORF Size 750 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_002306.1, NP_002297.1
RefSeq Size 1017 bp
RefSeq ORF 753 bp
Locus ID 3958
UniProt ID P17931
Cytogenetics 14q22.3
Domains Gal-bind_lectin
Protein Families Secreted Protein
MW 26.2 kDa
Summary This gene encodes a member of the galectin family of carbohydrate binding proteins. Members of this protein family have an affinity for beta-galactosides. The encoded protein is characterized by an N-terminal proline-rich tandem repeat domain and a single C-terminal carbohydrate recognition domain. This protein can self-associate through the N-terminal domain allowing it to bind to multivalent saccharide ligands. This protein localizes to the extracellular matrix, the cytoplasm and the nucleus. This protein plays a role in numerous cellular functions including apoptosis, innate immunity, cell adhesion and T-cell regulation. The protein exhibits antimicrobial activity against bacteria and fungi. Alternate splicing results in multiple transcript variants.[provided by RefSeq, Oct 2014]
Write Your Own Review
You're reviewing:Galectin 3 (LGALS3) (NM_002306) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC208785L1 Lenti ORF clone of Human lectin, galactoside-binding, soluble, 3 (LGALS3), transcript variant 1, Myc-DDK-tagged 10 ug
$600.00
RC208785L2 Lenti ORF clone of Human lectin, galactoside-binding, soluble, 3 (LGALS3), transcript variant 1, mGFP tagged 10 ug
$600.00
RC208785L3 Lenti ORF clone of Human lectin, galactoside-binding, soluble, 3 (LGALS3), transcript variant 1, Myc-DDK-tagged 10 ug
$600.00
RC208785L4 Lenti ORF clone of Human lectin, galactoside-binding, soluble, 3 (LGALS3), transcript variant 1, mGFP tagged 10 ug
$600.00
RG208785 LGALS3 (tGFP-tagged) - Human lectin, galactoside-binding, soluble, 3 (LGALS3), transcript variant 1 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC118706 LGALS3 (untagged)-Human lectin, galactoside-binding, soluble, 3 (LGALS3), transcript variant 1 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.