PEG10 (NM_001040152) Human Tagged ORF Clone

SKU
RC208683
PEG10 (Myc-DDK-tagged)-Human paternally expressed 10 (PEG10), transcript variant 1
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Target Symbol PEG10
Synonyms EDR; HB-1; Mar2; Mart2; MEF3L; RGAG3; RTL2; SIRH1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC208683 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGACCGAACGAAGAAGGGACGAGCTCTCTGAAGAGATCAACAACTTAAGAGAGAAGGTCATGAAGCAGT
CGGAGGAGAACAACAACCTGCAGAGCCAGGTGCAGAAGCTCACAGAGGAGAACACCACCCTTCGAGAGCA
AGTGGAACCCACCCCTGAGGATGAGGATGATGACATCGAGCTCCGCGGTGCTGCAGCAGCTGCTGCCCCA
CCCCCTCCAATAGAGGAAGAGTGCCCAGAAGACCTCCCAGAGAAGTTCGATGGCAACCCAGACATGCTGG
CTCCTTTCATGGCCCAGTGCCAGATCTTCATGGAAAAGAGCACCAGGGATTTCTCAGTTGATCGTGTCCG
TGTCTGCTTCGTGACAAGCATGATGACCGGCCGTGCTGCCCGTTGGGCCTCAGCAAAGCTGGAGCGCTCC
CACTACCTGATGCACAACTACCCAGCTTTCATGATGGAAATGAAGCATGTCTTTGAAGACCCTCAGAGGC
GAGAGGTTGCCAAACGCAAGATCAGACGCCTGCGCCAAGGCATGGGGTCTGTCATCGACTACTCCAATGC
TTTCCAGATGATTGCCCAGGACCTGGATTGGAACGAGCCTGCGCTGATTGACCAGTACCACGAGGGCCTC
AGCGACCACATTCAGGAGGAGCTCTCCCACCTCGAGGTCGCCAAGTCGCTGTCTGCTCTGATTGGGCAGT
GCATTCACATTGAGAGAAGGCTGGCCAGGGCTGCTGCAGCTCGCAAGCCACGCTCGCCACCCCGGGCGCT
GGTGTTGCCTCACATTGCAAGCCACCACCAGGTAGATCCAACCGAGCCGGTGGGAGGTGCCCGCATGCGC
CTGACGCAGGAAGAAAAAGAAAGACGCAGAAAGCTGAACCTGTGCCTCTACTGTGGAACAGGAGGTCACT
ACGCTGACAATTGTCCTGCCAAGGCCTCAAAGTCTTCGCCGGCGGGAAACTCCCCGGCCCCGCTG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC208683 protein sequence
Red=Cloning site Green=Tags(s)

MTERRRDELSEEINNLREKVMKQSEENNNLQSQVQKLTEENTTLREQVEPTPEDEDDDIELRGAAAAAAP
PPPIEEECPEDLPEKFDGNPDMLAPFMAQCQIFMEKSTRDFSVDRVRVCFVTSMMTGRAARWASAKLERS
HYLMHNYPAFMMEMKHVFEDPQRREVAKRKIRRLRQGMGSVIDYSNAFQMIAQDLDWNEPALIDQYHEGL
SDHIQEELSHLEVAKSLSALIGQCIHIERRLARAAAARKPRSPPRALVLPHIASHHQVDPTEPVGGARMR
LTQEEKERRRKLNLCLYCGTGGHYADNCPAKASKSSPAGNSPAPL

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_001040152
ORF Size 975 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_001040152.2
RefSeq Size 6628 bp
RefSeq ORF 978 bp
Locus ID 23089
UniProt ID Q86TG7
Cytogenetics 7q21.3
MW 37 kDa
Summary This is a paternally expressed imprinted gene that is thought to have been derived from the Ty3/Gypsy family of retrotransposons. It contains two overlapping open reading frames, RF1 and RF2, and expresses two proteins: a shorter, gag-like protein (with a CCHC-type zinc finger domain) from RF1; and a longer, gag/pol-like fusion protein (with an additional aspartic protease motif) from RF1/RF2 by -1 translational frameshifting (-1 FS). While -1 FS has been observed in RNA viruses and transposons in both prokaryotes and eukaryotes, this gene represents the first example of -1 FS in a eukaryotic cellular gene. This gene is highly conserved across mammalian species and retains the heptanucleotide (GGGAAAC) and pseudoknot elements required for -1 FS. It is expressed in adult and embryonic tissues (most notably in placenta) and reported to have a role in cell proliferation, differentiation and apoptosis. Overexpression of this gene has been associated with several malignancies, such as hepatocellular carcinoma and B-cell lymphocytic leukemia. Knockout mice lacking this gene showed early embryonic lethality with placental defects, indicating the importance of this gene in embryonic development. Additional isoforms resulting from alternatively spliced transcript variants, and use of upstream non-AUG (CUG) start codon have been reported for this gene. [provided by RefSeq, Oct 2014]
Write Your Own Review
You're reviewing:PEG10 (NM_001040152) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC208683L3 Lenti ORF clone of Human paternally expressed 10 (PEG10), transcript variant 1, Myc-DDK-tagged 10 ug
$600.00
RC208683L4 Lenti ORF clone of Human paternally expressed 10 (PEG10), transcript variant 1, mGFP tagged 10 ug
$600.00
RG208683 PEG10 (tGFP-tagged) - Human paternally expressed 10 (PEG10), transcript variant 1 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC324334 PEG10 (untagged)-Human paternally expressed 10 (PEG10), transcript variant 1 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.