EIF4EBP2 (NM_004096) Human Tagged ORF Clone

SKU
RC208664
EIF4EBP2 (Myc-DDK-tagged)-Human eukaryotic translation initiation factor 4E binding protein 2 (EIF4EBP2)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$150.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol EIF4EBP2
Synonyms 4EBP2; PHASII
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC208664 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCCTCGTCAGCCGGCAGCGGCCACCAGCCCAGCCAGAGCCGCGCCATCCCCACCCGCACCGTGGCCA
TCAGCGACGCCGCGCAGCTACCTCATGACTATTGCACCACGCCCGGGGGGACGCTCTTCTCCACCACACC
GGGAGGAACTCGAATCATTTATGACAGAAAGTTTCTGTTGGATCGTCGCAATTCTCCCATGGCTCAGACC
CCACCCTGCCACCTGCCCAATATCCCAGGAGTCACTAGCCCTGGCACCTTAATTGAAGACTCCAAAGTAG
AAGTAAACAATTTGAACAACTTGAACAATCACGACAGGAAACATGCAGTTGGGGATGATGCTCAGTTCGA
GATGGACATC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC208664 protein sequence
Red=Cloning site Green=Tags(s)

MSSSAGSGHQPSQSRAIPTRTVAISDAAQLPHDYCTTPGGTLFSTTPGGTRIIYDRKFLLDRRNSPMAQT
PPCHLPNIPGVTSPGTLIEDSKVEVNNLNNLNNHDRKHAVGDDAQFEMDI

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_004096
ORF Size 360 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_004096.5
RefSeq Size 7531 bp
RefSeq ORF 363 bp
Locus ID 1979
UniProt ID Q13542
Cytogenetics 10q22.1
Protein Families Transcription Factors
MW 12.9 kDa
Summary This gene encodes a member of the eukaryotic translation initiation factor 4E binding protein family. The gene products of this family bind eIF4E and inhibit translation initiation. However, insulin and other growth factors can release this inhibition via a phosphorylation-dependent disruption of their binding to eIF4E. Regulation of protein production through these gene products have been implicated in cell proliferation, cell differentiation and viral infection. [provided by RefSeq, Oct 2008]
Write Your Own Review
You're reviewing:EIF4EBP2 (NM_004096) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC208664L3 Lenti ORF clone of Human eukaryotic translation initiation factor 4E binding protein 2 (EIF4EBP2), Myc-DDK-tagged 10 ug
$450.00
RC208664L4 Lenti ORF clone of Human eukaryotic translation initiation factor 4E binding protein 2 (EIF4EBP2), mGFP tagged 10 ug
$450.00
RG208664 EIF4EBP2 (tGFP-tagged) - Human eukaryotic translation initiation factor 4E binding protein 2 (EIF4EBP2) 10 ug
$489.00
SC117589 EIF4EBP2 (untagged)-Human eukaryotic translation initiation factor 4E binding protein 2 (EIF4EBP2) 10 ug
$150.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.