RAB5B (NM_002868) Human Tagged ORF Clone

  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

SKU
RC208529
RAB5B (Myc-DDK-tagged)-Human RAB5B, member RAS oncogene family (RAB5B)
$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol RAB5B
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC208529 representing NM_002868
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGACTAGCAGAAGCACAGCTAGGCCCAATGGGCAACCCCAGGCCAGCAAAATTTGCCAGTTCAAATTGG
TCCTGCTGGGAGAATCTGCAGTGGGAAAGTCAAGCCTGGTATTACGTTTTGTCAAAGGGCAGTTCCATGA
GTACCAGGAGAGCACCATTGGAGCGGCCTTCCTCACCCAGTCCGTTTGTCTAGATGACACAACAGTGAAG
TTTGAGATCTGGGACACAGCTGGGCAGGAGCGATATCACAGCTTAGCCCCCATGTACTACAGGGGTGCCC
AAGCTGCAATCGTGGTTTACGACATTACTAATCAGGAAACCTTTGCCCGAGCAAAGACATGGGTGAAGGA
ACTACAGCGACAGGCCAGTCCTAGCATCGTTATTGCCCTGGCAGGGAACAAAGCTGACCTGGCCAACAAA
CGTATGGTGGAGTATGAAGAGGCCCAGGCATATGCAGATGACAACAGCTTATTGTTCATGGAGACTTCAG
CCAAGACAGCTATGAACGTGAATGATCTCTTCCTGGCAATAGCTAAGAAGTTGCCAAAGAGTGAACCCCA
GAATCTGGGAGGTGCAGCAGGCCGAAGCCGGGGTGTGGATCTCCATGAACAGTCCCAGCAGAACAAGAGC
CAGTGTTGTAGCAAC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC208529 representing NM_002868
Red=Cloning site Green=Tags(s)

MTSRSTARPNGQPQASKICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQSVCLDDTTVK
FEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNQETFARAKTWVKELQRQASPSIVIALAGNKADLANK
RMVEYEEAQAYADDNSLLFMETSAKTAMNVNDLFLAIAKKLPKSEPQNLGGAAGRSRGVDLHEQSQQNKS
QCCSN

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_002868
ORF Size 645 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_002868.4
RefSeq Size 3336 bp
RefSeq ORF 648 bp
Locus ID 5869
UniProt ID P61020
Cytogenetics 12q13.2
Domains RAB, RAN, ras, RAS, RHO
Protein Families Druggable Genome
Protein Pathways Endocytosis
MW 23.5 kDa
Summary Protein transport. Probably involved in vesicular traffic (By similarity).[UniProtKB/Swiss-Prot Function]
 
 
 
 
 
Be the first to review this product
SKU Description Size Price
RC208529L1 Lenti ORF clone of Human RAB5B, member RAS oncogene family (RAB5B), Myc-DDK-tagged 10 ug
$600.00
RC208529L2 Lenti ORF clone of Human RAB5B, member RAS oncogene family (RAB5B), mGFP tagged 10 ug
$600.00
RC208529L3 Lenti ORF clone of Human RAB5B, member RAS oncogene family (RAB5B), Myc-DDK-tagged 10 ug
$600.00
RC208529L4 Lenti ORF clone of Human RAB5B, member RAS oncogene family (RAB5B), mGFP tagged 10 ug
$600.00
RG208529 RAB5B (tGFP-tagged) - Human RAB5B, member RAS oncogene family (RAB5B) 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC118354 RAB5B (untagged)-Human RAB5B, member RAS oncogene family (RAB5B) 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.