Ninjurin 1 (NINJ1) (NM_004148) Human Tagged ORF Clone

SKU
RC208335
NINJ1 (Myc-DDK-tagged)-Human ninjurin 1 (NINJ1)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$150.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol Ninjurin 1
Synonyms NIN1; NINJURIN
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC208335 representing NM_004148.
Blue=ORF Red=Cloning site Green=Tag(s)

GCTCGTTTAGTGAACCGTCAGAATTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTG
GATCCGGTACCGAGGAGATCTGCCGCCGCGATCGCC
ATGGACTCGGGAACCGAGGAGTACGAGCTCAACGGCGGCCTGCCTCCGGGCACACCCGGCTCCCCGGAC
GCCTCGCCGGCCCGCTGGGGCTGGAGGCACGGGCCCATCAACGTGAACCATTACGCCAGCAAGAAGAGC
GCAGCCGAGAGCATGCTGGACATCGCGCTGCTGATGGCCAACGCGTCCCAGCTGAAGGCCGTCGTGGAA
CAGGGCCCCAGCTTCGCCTTCTATGTGCCCCTGGTGGTCCTCATCTCCATCTCCCTTGTGCTGCAGATC
GGCGTGGGGGTGCTGCTCATCTTCCTTGTCAAGTACGACCTTAACAACCCGGCCAAGCACGCCAAGCTG
GACTTCCTCAACAACCTGGCCACGGGCCTGGTGTTCATCATCGTGGTAGTCAACATCTTCATCACGGCC
TTCGGGGTCCAGAAGCCCTTGATGGACATGGCACCCCAGCAG

AGCGGACCGACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGAT
ATCCTGGATTACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>Peptide sequence encoded by RC208335
Blue=ORF Red=Cloning site Green=Tag(s)

MDSGTEEYELNGGLPPGTPGSPDASPARWGWRHGPINVNHYASKKSAAESMLDIALLMANASQLKAVVE
QGPSFAFYVPLVVLISISLVLQIGVGVLLIFLVKYDLNNPAKHAKLDFLNNLATGLVFIIVVVNIFITA
FGVQKPLMDMAPQQ

SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-RsrII Cloning Scheme for this gene Plasmid Map
ACCN NM_004148
ORF Size 456 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_004148.4
RefSeq Size 1309 bp
RefSeq ORF 459 bp
Locus ID 4814
UniProt ID Q92982
Cytogenetics 9q22.31
Protein Families Transmembrane
MW 16.3 kDa
Summary The ninjurin protein is upregulated after nerve injury both in dorsal root ganglion neurons and in Schwann cells (Araki and Milbrandt, 1996 [PubMed 8780658]). It demonstrates properties of a homophilic adhesion molecule and promotes neurite outgrowth from primary cultured dorsal root ganglion neurons.[supplied by OMIM, Aug 2009]
Write Your Own Review
You're reviewing:Ninjurin 1 (NINJ1) (NM_004148) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC208335L1 Lenti ORF clone of Human ninjurin 1 (NINJ1), Myc-DDK-tagged 10 ug
$450.00
RC208335L2 Lenti ORF clone of Human ninjurin 1 (NINJ1), mGFP tagged 10 ug
$450.00
RC208335L3 Lenti ORF clone of Human ninjurin 1 (NINJ1), Myc-DDK-tagged 10 ug
$450.00
RC208335L4 Lenti ORF clone of Human ninjurin 1 (NINJ1), mGFP tagged 10 ug
$450.00
RG208335 NINJ1 (tGFP-tagged) - Human ninjurin 1 (NINJ1) 10 ug
$489.00
SC117550 NINJ1 (untagged)-Human ninjurin 1 (NINJ1) 10 ug
$150.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.