LYPD6 (NM_194317) Human Tagged ORF Clone

SKU
RC208297
LYPD6 (Myc-DDK-tagged)-Human LY6/PLAUR domain containing 6 (LYPD6), transcript variant 2
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol LYPD6
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC208297 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAACCTGGCCCTGCTCTGGCCTGGCTCCTGCTCCTGAGCCTGCTGGCGGATTGTCTGAAAGCTGCTC
AGTCCCGAGACTTCACAGTGAAAGACATTATCTACCTCCATCCTTCAACCACACCATATCCTGGTGGATT
TAAATGTTTCACCTGTGAAAAGGCAGCAGACAATTATGAGTGCAACCGATGGGCTCCAGACATCTACTGC
CCTCGAGAGACCAGATACTGCTACACTCAGCACACAATGGAAGTCACAGGAAACAGTATCTCAGTCACCA
AACGCTGTGTCCCACTGGAAGAGTGCTTATCCACTGGCTGCAGAGACTCCGAGCATGAAGGCCACAAGGT
CTGCACTTCTTGTTGTGAAGGAAATATCTGTAACTTGCCACTGCCCCGAAATGAAACTGATGCCACATTT
GCCACGACGTCACCTATAAATCAGACAAATGGGCACCCACGCTGTATGTCAGTGATAGTGTCCTGCTTGT
GGTTGTGGTTAGGGCTCATGTTA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC208297 protein sequence
Red=Cloning site Green=Tags(s)

MEPGPALAWLLLLSLLADCLKAAQSRDFTVKDIIYLHPSTTPYPGGFKCFTCEKAADNYECNRWAPDIYC
PRETRYCYTQHTMEVTGNSISVTKRCVPLEECLSTGCRDSEHEGHKVCTSCCEGNICNLPLPRNETDATF
ATTSPINQTNGHPRCMSVIVSCLWLWLGLML

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_194317
ORF Size 513 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_194317.5
RefSeq Size 4101 bp
RefSeq ORF 516 bp
Locus ID 130574
UniProt ID Q86Y78
Cytogenetics 2q23.2
Protein Families Secreted Protein
MW 19.1 kDa
Summary Members of the LY6 protein family (see SLURP1; MIM 606119), such as LYPD6, have at least one 80-amino acid LU domain that contains 10 conserved cysteines with a defined disulfide-bonding pattern (Zhang et al., 2010 [PubMed 19653121]).[supplied by OMIM, Apr 2010]
Write Your Own Review
You're reviewing:LYPD6 (NM_194317) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC208297L3 Lenti ORF clone of Human LY6/PLAUR domain containing 6 (LYPD6), transcript variant 2, Myc-DDK-tagged 10 ug
$600.00
RC208297L4 Lenti ORF clone of Human LY6/PLAUR domain containing 6 (LYPD6), transcript variant 2, mGFP tagged 10 ug
$600.00
RG208297 LYPD6 (tGFP-tagged) - Human LY6/PLAUR domain containing 6 (LYPD6), transcript variant 2 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC124893 LYPD6 (untagged)-Human LY6/PLAUR domain containing 6 (LYPD6), transcript variant 2 10 ug
$300.00
SC322635 LYPD6 (untagged)-Human LY6/PLAUR domain containing 6 (LYPD6), transcript variant 2 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.