OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

RNF144 (RNF144A) (NM_014746) Human Tagged ORF Clone

  • Product Brand Image
Be the first to review this product
SKU
RC208254
RNF144A (Myc-DDK-tagged)-Human ring finger protein 144A (RNF144A)
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK mGFP DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
  $300.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (6)

TA347724 Rabbit Polyclonal Anti-RNF144A Antibody
100 ug
$380.00
TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "RNF144 or NM_014746"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol RNF144
Synonyms hUIP4; RNF144; UBCE7IP4
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC208254 representing NM_014746
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGACCACAGCAAGGTACCGGCCCACCTGGGACCTGGCCCTCGACCCGCTGGTGTCTTGCAAGCTCTGTC
TTGGGGAGTACCCAGTGGAGCAGATGACAACCATAGCCCAGTGCCAATGCATCTTCTGTACTCTGTGCCT
GAAACAGTATGTTGAGCTCTTGATCAAAGAAGGATTAGAAACCGCAATTAGCTGCCCAGATGCTGCCTGC
CCTAAACAGGGCCACCTACAGGAGAACGAGATTGAGTGCATGGTTGCAGCTGAAATTATGCAAAGATATA
AAAAGCTACAATTTGAAAGAGAGGTGCTGTTTGATCCCTGTCGGACTTGGTGCCCGGCGTCCACCTGCCA
AGCTGTGTGTCAGCTCCAGGACGTGGGGCTGCAGACCCCCCAGCCAGTGCAGTGCAAAGCCTGCCGTATG
GAATTCTGCTCCACCTGCAAAGCCAGCTGGCACCCTGGCCAGGGCTGCCCGGAGACCATGCCGATCACCT
TCCTCCCCGGGGAGACCAGTGCTGCTTTCAAAATGGAAGAAGATGACGCGCCCATCAAGCGCTGCCCCAA
GTGCAAAGTCTACATCGAGCGAGACGAAGGCTGCGCGCAGATGATGTGCAAGAACTGCAAGCACGCCTTC
TGCTGGTACTGCCTGGAGTCTCTGGACGATGATTTCCTTCTGATACACTACGATAAGGGACCCTGCCGGA
ACAAGCTGGGCCACTCCCGGGCATCTGTGATCTGGCATCGGACACAGGTTGTGGGCATTTTTGCAGGATT
TGGGCTGCTGCTCTTGGTGGCCTCACCTTTCCTACTCCTGGCCACTCCCTTTGTACTTTGCTGCAAGTGC
AAGTGCAGTAAAGGTGACGACGACCCGTTACCCACC

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>RC208254 representing NM_014746
Red=Cloning site Green=Tags(s)

MTTARYRPTWDLALDPLVSCKLCLGEYPVEQMTTIAQCQCIFCTLCLKQYVELLIKEGLETAISCPDAAC
PKQGHLQENEIECMVAAEIMQRYKKLQFEREVLFDPCRTWCPASTCQAVCQLQDVGLQTPQPVQCKACRM
EFCSTCKASWHPGQGCPETMPITFLPGETSAAFKMEEDDAPIKRCPKCKVYIERDEGCAQMMCKNCKHAF
CWYCLESLDDDFLLIHYDKGPCRNKLGHSRASVIWHRTQVVGIFAGFGLLLLVASPFLLLATPFVLCCKC
KCSKGDDDPLPT

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_014746
ORF Size 876 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_014746.1
RefSeq Size 5755 bp
RefSeq ORF 879 bp
Locus ID 9781
UniProt ID P50876
Cytogenetics 2p25.1
Domains IBR
Protein Families Druggable Genome, Transmembrane
MW 32.7 kDa
Summary This gene encodes a member of a family of RING finger domain-containing E3 ubiquitin ligases that also includes parkin and parc. The expression of this gene is induced by DNA damage. The encoded protein interacts with the cytoplasmic DNA-dependent protein kinase, catalytic subunit (DNA-PKcs) and promotes its degradation through ubiquitination. The orthologous mouse protein has been shown to interact with a ubiquitin-conjugating enzyme involved in embryonic development. provided by RefSeq, Mar 2017
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_014746" in other vectors (6)
SKU Description Size Price
RC208254L1 Lenti ORF clone of Human ring finger protein 144A (RNF144A), Myc-DDK-tagged 10 ug
$600.00
RC208254L2 Lenti ORF clone of Human ring finger protein 144A (RNF144A), mGFP tagged 10 ug
$600.00
RC208254L3 Lenti ORF clone of Human ring finger protein 144A (RNF144A), Myc-DDK-tagged 10 ug
$600.00
RC208254L4 Lenti ORF clone of Human ring finger protein 144A (RNF144A), mGFP tagged 10 ug
$600.00
RG208254 RNF144A (tGFP-tagged) - Human ring finger protein 144A (RNF144A) 10 ug
$489.00 $500.00
SC321826 RNF144A (untagged)-Human ring finger protein 144A (RNF144A) 10 ug
$300.00

Plasmid Map for RC208254

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for RC208254
Circular map for RC208254

file-alt Citations

RNF144A functions as a tumor suppressor in breast cancer through ubiquitin ligase activity-dependent regulation of stability and oncogenic functions of HSPA2
Yang, Zhang, Li et al
Cell Death Differ. (2019)
AI Summary: OriGene contributed Myc-DDK-tagged-RNF144A cDNA and RNF144A shRNA lentiviral constructs (shRNF144A #1), as well as corresponding control constructs, which were used in this study to manipulate RNF144A expression and investigate its tumor suppressor function in breast cancer.
Snippet: DNA constructs, transfection, and viral transduction Myc-DDK-tagged-RNF144A cDNA, RNF144A short hair- pin RNA (shRNA) lentiviral constructs (shRNF144A #1), and corresponding control constructs were purchased from Origene (Rockville, USA)
RBR-type E3 ubiquitin ligase RNF144A targets PARP1 for ubiquitin-dependent degradation and regulates PARP inhibitor sensitivity in breast cancer cells
Zhang, Liao, Xie et al
Oncotarget (2017) 8 (55), 94505-94518 DOI: 10.18632/oncotarget.21784
Snippet: Myc-DDK-tagged-human RNF144A and PARP1 expression vectors, human RNF144A short hairpin RNA (shRNA) in pGFP-C-shLenti vector, and the corresponding control expression vectors were purchased from Origene (Rockville, MD, USA)
FigureFigureFigure
Showing 1-2 of 2 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products