RNF144 (RNF144A) (NM_014746) Human Tagged ORF Clone

SKU
RC208254
RNF144A (Myc-DDK-tagged)-Human ring finger protein 144A (RNF144A)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol RNF144
Synonyms hUIP4; RNF144; UBCE7IP4
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC208254 representing NM_014746
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGACCACAGCAAGGTACCGGCCCACCTGGGACCTGGCCCTCGACCCGCTGGTGTCTTGCAAGCTCTGTC
TTGGGGAGTACCCAGTGGAGCAGATGACAACCATAGCCCAGTGCCAATGCATCTTCTGTACTCTGTGCCT
GAAACAGTATGTTGAGCTCTTGATCAAAGAAGGATTAGAAACCGCAATTAGCTGCCCAGATGCTGCCTGC
CCTAAACAGGGCCACCTACAGGAGAACGAGATTGAGTGCATGGTTGCAGCTGAAATTATGCAAAGATATA
AAAAGCTACAATTTGAAAGAGAGGTGCTGTTTGATCCCTGTCGGACTTGGTGCCCGGCGTCCACCTGCCA
AGCTGTGTGTCAGCTCCAGGACGTGGGGCTGCAGACCCCCCAGCCAGTGCAGTGCAAAGCCTGCCGTATG
GAATTCTGCTCCACCTGCAAAGCCAGCTGGCACCCTGGCCAGGGCTGCCCGGAGACCATGCCGATCACCT
TCCTCCCCGGGGAGACCAGTGCTGCTTTCAAAATGGAAGAAGATGACGCGCCCATCAAGCGCTGCCCCAA
GTGCAAAGTCTACATCGAGCGAGACGAAGGCTGCGCGCAGATGATGTGCAAGAACTGCAAGCACGCCTTC
TGCTGGTACTGCCTGGAGTCTCTGGACGATGATTTCCTTCTGATACACTACGATAAGGGACCCTGCCGGA
ACAAGCTGGGCCACTCCCGGGCATCTGTGATCTGGCATCGGACACAGGTTGTGGGCATTTTTGCAGGATT
TGGGCTGCTGCTCTTGGTGGCCTCACCTTTCCTACTCCTGGCCACTCCCTTTGTACTTTGCTGCAAGTGC
AAGTGCAGTAAAGGTGACGACGACCCGTTACCCACC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC208254 representing NM_014746
Red=Cloning site Green=Tags(s)

MTTARYRPTWDLALDPLVSCKLCLGEYPVEQMTTIAQCQCIFCTLCLKQYVELLIKEGLETAISCPDAAC
PKQGHLQENEIECMVAAEIMQRYKKLQFEREVLFDPCRTWCPASTCQAVCQLQDVGLQTPQPVQCKACRM
EFCSTCKASWHPGQGCPETMPITFLPGETSAAFKMEEDDAPIKRCPKCKVYIERDEGCAQMMCKNCKHAF
CWYCLESLDDDFLLIHYDKGPCRNKLGHSRASVIWHRTQVVGIFAGFGLLLLVASPFLLLATPFVLCCKC
KCSKGDDDPLPT

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_014746
ORF Size 876 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_014746.1
RefSeq Size 5755 bp
RefSeq ORF 879 bp
Locus ID 9781
UniProt ID P50876
Cytogenetics 2p25.1
Domains IBR
Protein Families Druggable Genome, Transmembrane
MW 32.7 kDa
Summary This gene encodes a member of a family of RING finger domain-containing E3 ubiquitin ligases that also includes parkin and parc. The expression of this gene is induced by DNA damage. The encoded protein interacts with the cytoplasmic DNA-dependent protein kinase, catalytic subunit (DNA-PKcs) and promotes its degradation through ubiquitination. The orthologous mouse protein has been shown to interact with a ubiquitin-conjugating enzyme involved in embryonic development. [provided by RefSeq, Mar 2017]
Write Your Own Review
You're reviewing:RNF144 (RNF144A) (NM_014746) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC208254L1 Lenti ORF clone of Human ring finger protein 144A (RNF144A), Myc-DDK-tagged 10 ug
$600.00
RC208254L2 Lenti ORF clone of Human ring finger protein 144A (RNF144A), mGFP tagged 10 ug
$600.00
RC208254L3 Lenti ORF clone of Human ring finger protein 144A (RNF144A), Myc-DDK-tagged 10 ug
$600.00
RC208254L4 Lenti ORF clone of Human ring finger protein 144A (RNF144A), mGFP tagged 10 ug
$600.00
RG208254 RNF144A (tGFP-tagged) - Human ring finger protein 144A (RNF144A) 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC321826 RNF144A (untagged)-Human ring finger protein 144A (RNF144A) 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.