RNF11 (NM_014372) Human Tagged ORF Clone

SKU
RC208220
RNF11 (Myc-DDK-tagged)-Human ring finger protein 11 (RNF11)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$150.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol RNF11
Synonyms CGI-123; SID1669
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC208220 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGGGAACTGCCTCAAATCCCCCACCTCGGATGACATCTCCCTGCTTCACGAGTCTCAGTCCGACCGGG
CTAGCTTTGGCGAGGGGACGGAGCCGGATCAGGAGCCGCCGCCGCCATATCAGGAACAAGTTCCAGTTCC
AGTCTACCACCCAACACCTAGCCAGACTCGGCTAGCAACTCAGCTGACTGAAGAGGAACAAATTAGGATA
GCTCAAAGAATAGGTCTTATACAACATCTGCCTAAAGGAGTTTATGACCCTGGAAGAGATGGATCAGAAA
AAAAGATCCGGGAGTGTGTGATCTGTATGATGGACTTTGTTTATGGGGACCCAATTCGATTTCTGCCGTG
CATGCACATCTATCACCTGGACTGTATAGATGACTGGTTGATGAGATCCTTCACGTGCCCCTCCTGCATG
GAGCCAGTTGATGCAGCACTGCTTTCATCCTATGAGACTAAT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC208220 protein sequence
Red=Cloning site Green=Tags(s)

MGNCLKSPTSDDISLLHESQSDRASFGEGTEPDQEPPPPYQEQVPVPVYHPTPSQTRLATQLTEEEQIRI
AQRIGLIQHLPKGVYDPGRDGSEKKIRECVICMMDFVYGDPIRFLPCMHIYHLDCIDDWLMRSFTCPSCM
EPVDAALLSSYETN

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_014372
ORF Size 462 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_014372.5
RefSeq Size 3082 bp
RefSeq ORF 465 bp
Locus ID 26994
UniProt ID Q9Y3C5
Cytogenetics 1p32.3
Domains RING
Protein Families Druggable Genome
MW 17.4 kDa
Summary The protein encoded by this gene contains a RING-H2 finger motif, which is known to be important for protein-protein interactions. The expression of this gene has been shown to be induced by mutant RET proteins (MEN2A/MEN2B). The germline mutations in RET gene are known to be responsible for the development of multiple endocrine neoplasia (MEN). [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:RNF11 (NM_014372) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC208220L1 Lenti ORF clone of Human ring finger protein 11 (RNF11), Myc-DDK-tagged 10 ug
$450.00
RC208220L2 Lenti ORF clone of Human ring finger protein 11 (RNF11), mGFP tagged 10 ug
$450.00
RC208220L3 Lenti ORF clone of Human ring finger protein 11 (RNF11), Myc-DDK-tagged 10 ug
$450.00
RC208220L4 Lenti ORF clone of Human ring finger protein 11 (RNF11), mGFP tagged 10 ug
$450.00
RG208220 RNF11 (tGFP-tagged) - Human ring finger protein 11 (RNF11) 10 ug
$489.00
SC115021 RNF11 (untagged)-Human ring finger protein 11 (RNF11) 10 ug
$150.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.