HNRPH3 (HNRNPH3) (NM_021644) Human Tagged ORF Clone

SKU
RC208027
HNRNPH3 (Myc-DDK-tagged)-Human heterogeneous nuclear ribonucleoprotein H3 (2H9) (HNRNPH3), transcript variant 2H9A
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol HNRPH3
Synonyms 2H9; HNRPH3
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC208027 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGATTGGGTTATGAAACATAATGGTCCAAATGACGCTAGTGATGGGACAGTACGACTTCGTGGACTAC
CATTTGGTTGCAGCAAAGAGGAAATAGTTCAGTTCTTTCAAGGGTTGGAAATCGTGCCAAATGGGATAAC
ATTGACGATGGACTACCAGGGGAGAAGCACAGGGGAGGCCTTCGTGCAGTTTGCTTCAAAGGAGATAGCA
GAAAATGCTCTGGGGAAACACAAGGAAAGAATAGGGCACAGGTATATTGAGATCTTCAGAAGTAGCAGGA
GTGAAATCAAAGGATTTTATGATCCACCAAGAAGATTGCTGGGACAGCGACCGGGACCATATGATAGACC
AATAGGAGGAAGAGGGGGTTATTATGGAGCTGGGCGTGGAAGTTATGGAGGTTTTGATGACTATGGTGGC
TATAATAATTACGGCTATGGGAATGATGGCTTTGATGACAGAATGAGAGATGGAAGAGGTATGGGAGGAC
ATGGCTATGGTGGAGCTGGTGATGCAAGTTCAGGTTTTCATGGTGGTCATTTCGTACATATGAGAGGGTT
GCCTTTTCGTGCAACTGAAAATGACATTGCTAATTTCTTCTCACCACTAAATCCAATACGAGTTCATATT
GATATTGGAGCTGATGGCAGAGCCACAGGAGAAGCAGATGTAGAGTTTGTGACACATGAAGATGCAGTAG
CTGCCATGTCTAAAGATAAAAATAACATGCAACATCGATATATTGAACTCTTCTTGAATTCTACTCCTGG
AGGCGGCTCTGGCATGGGAGGTTCTGGAATGGGAGGCTACGGAAGAGATGGAATGGATAATCAGGGAGGC
TATGGATCAGTTGGAAGAATGGGAATGGGGAACAATTACAGTGGAGGATATGGTACTCCTGATGGTTTGG
GTGGTTATGGCCGTGGTGGTGGAGGCAGTGGAGGTTACTATGGGCAAGGCGGCATGAGTGGAGGTGGATG
GCGTGGGATGTAC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC208027 protein sequence
Red=Cloning site Green=Tags(s)

MDWVMKHNGPNDASDGTVRLRGLPFGCSKEEIVQFFQGLEIVPNGITLTMDYQGRSTGEAFVQFASKEIA
ENALGKHKERIGHRYIEIFRSSRSEIKGFYDPPRRLLGQRPGPYDRPIGGRGGYYGAGRGSYGGFDDYGG
YNNYGYGNDGFDDRMRDGRGMGGHGYGGAGDASSGFHGGHFVHMRGLPFRATENDIANFFSPLNPIRVHI
DIGADGRATGEADVEFVTHEDAVAAMSKDKNNMQHRYIELFLNSTPGGGSGMGGSGMGGYGRDGMDNQGG
YGSVGRMGMGNNYSGGYGTPDGLGGYGRGGGGSGGYYGQGGMSGGGWRGMY

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_021644
ORF Size 993 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_021644.3, NP_067676.2
RefSeq Size 2382 bp
RefSeq ORF 996 bp
Locus ID 3189
UniProt ID P31942
Cytogenetics 10q21.3
Domains RRM
MW 35.2 kDa
Summary This gene belongs to the subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm. The hnRNP proteins have distinct nucleic acid binding properties. The protein encoded by this gene has two repeats of quasi-RRM domains that bind to RNAs. It is localized in nuclear bodies of the nucleus. This protein is involved in the splicing process and it also participates in early heat shock-induced splicing arrest by transiently leaving the hnRNP complexes. Several alternatively spliced transcript variants have been noted for this gene, however, not all are fully characterized. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:HNRPH3 (HNRNPH3) (NM_021644) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC208027L3 Lenti ORF clone of Human heterogeneous nuclear ribonucleoprotein H3 (2H9) (HNRNPH3), transcript variant 2H9A, Myc-DDK-tagged 10 ug
$600.00
RC208027L4 Lenti ORF clone of Human heterogeneous nuclear ribonucleoprotein H3 (2H9) (HNRNPH3), transcript variant 2H9A, mGFP tagged 10 ug
$600.00
RG208027 HNRNPH3 (tGFP-tagged) - Human heterogeneous nuclear ribonucleoprotein H3 (2H9) (HNRNPH3), transcript variant 2H9A 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC109315 HNRNPH3 (untagged)-Human heterogeneous nuclear ribonucleoprotein H3 (2H9) (HNRNPH3), transcript variant 2H9A 10 ug
$727.00
SC317504 HNRNPH3 (untagged)-Human heterogeneous nuclear ribonucleoprotein H3 (2H9) (HNRNPH3), transcript variant 2H9A 10 ug
$330.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.