PCBP1 (NM_006196) Human Tagged ORF Clone

SKU
RC207878
PCBP1 (Myc-DDK-tagged)-Human poly(rC) binding protein 1 (PCBP1)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$457.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol PCBP1
Synonyms HEL-S-85; hnRNP-E1; hnRNP-X; HNRPE1; HNRPX
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC207878 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGATGCCGGTGTGACTGAAAGTGGACTAAATGTGACTCTCACCATTCGGCTTCTTATGCACGGAAAGG
AAGTAGGAAGCATCATTGGGAAGAAAGGGGAGTCGGTTAAGAGGATCCGCGAGGAGAGTGGCGCGCGGAT
CAACATCTCGGAGGGGAATTGTCCGGAGAGAATCATCACTCTGACCGGCCCCACCAATGCCATCTTTAAG
GCTTTCGCTATGATCATCGACAAGCTGGAGGAAGATATCAACAGCTCCATGACCAACAGTACCGCGGCCA
GCAGGCCCCCGGTCACCCTGAGGCTGGTGGTGCCGGCCACCCAGTGCGGCTCCCTGATTGGGAAAGGCGG
GTGTAAGATCAAAGAGATCCGCGAGAGTACGGGGGCGCAGGTCCAGGTGGCGGGGGATATGCTGCCCAAC
TCCACCGAGCGGGCCATCACCATCGCTGGCGTGCCGCAGTCTGTCACCGAGTGTGTCAAGCAGATTTGCC
TGGTCATGCTGGAGACGCTCTCCCAGTCTCCGCAAGGGAGAGTCATGACCATTCCGTACCAGCCCATGCC
GGCCAGCTCCCCAGTCATCTGCGCGGGCGGCCAAGATCGGTGCAGCGACGCTGCGGGCTACCCCCATGCC
ACCCATGACCTGGAGGGACCACCTCTAGATGCCTACTCGATTCAAGGACAACACACCATTTCTCCGCTCG
ATCTGGCCAAGCTGAACCAGGTGGCAAGACAACAGTCTCACTTTGCCATGATGCACGGCGGGACCGGATT
CGCCGGAATTGACTCCAGCTCTCCAGAGGTGAAAGGCTATTGGGCAAGTTTGGATGCATCTACTCAAACC
ACCCATGAACTCACCATTCCAAATAACTTAATTGGCTGCATAATCGGGCGCCAAGGCGCCAACATTAATG
AGATCCGCCAGATGTCCGGGGCCCAGATCAAAATTGCCAACCCAGTGGAAGGCTCCTCTGGTAGGCAGGT
TACTATCACTGGCTCTGCTGCCAGTATTAGTCTGGCCCAGTATCTAATCAATGCCAGGCTTTCCTCTGAG
AAGGGCATGGGGTGCAGC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC207878 protein sequence
Red=Cloning site Green=Tags(s)

MDAGVTESGLNVTLTIRLLMHGKEVGSIIGKKGESVKRIREESGARINISEGNCPERIITLTGPTNAIFK
AFAMIIDKLEEDINSSMTNSTAASRPPVTLRLVVPATQCGSLIGKGGCKIKEIRESTGAQVQVAGDMLPN
STERAITIAGVPQSVTECVKQICLVMLETLSQSPQGRVMTIPYQPMPASSPVICAGGQDRCSDAAGYPHA
THDLEGPPLDAYSIQGQHTISPLDLAKLNQVARQQSHFAMMHGGTGFAGIDSSSPEVKGYWASLDASTQT
THELTIPNNLIGCIIGRQGANINEIRQMSGAQIKIANPVEGSSGRQVTITGSAASISLAQYLINARLSSE
KGMGCS

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_006196
ORF Size 1068 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_006196.4
RefSeq Size 1772 bp
RefSeq ORF 1071 bp
Locus ID 5093
UniProt ID Q15365
Cytogenetics 2p13.3
Domains KH
Protein Pathways Spliceosome
MW 37.5 kDa
Summary This intronless gene is thought to have been generated by retrotransposition of a fully processed PCBP-2 mRNA. This gene and PCBP-2 have paralogues (PCBP3 and PCBP4) which are thought to have arisen as a result of duplication events of entire genes. The protein encoded by this gene appears to be multifunctional. It along with PCBP-2 and hnRNPK corresponds to the major cellular poly(rC)-binding protein. It contains three K-homologous (KH) domains which may be involved in RNA binding. This encoded protein together with PCBP-2 also functions as translational coactivators of poliovirus RNA via a sequence-specific interaction with stem-loop IV of the IRES and promote poliovirus RNA replication by binding to its 5'-terminal cloverleaf structure. It has also been implicated in translational control of the 15-lipoxygenase mRNA, human Papillomavirus type 16 L2 mRNA, and hepatitis A virus RNA. The encoded protein is also suggested to play a part in formation of a sequence-specific alpha-globin mRNP complex which is associated with alpha-globin mRNA stability. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:PCBP1 (NM_006196) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC207878L1 Lenti ORF clone of Human poly(rC) binding protein 1 (PCBP1), Myc-DDK-tagged 10 ug
$757.00
RC207878L2 Lenti ORF clone of Human poly(rC) binding protein 1 (PCBP1), mGFP tagged 10 ug
$757.00
RC207878L3 Lenti ORF clone of Human poly(rC) binding protein 1 (PCBP1), Myc-DDK-tagged 10 ug
$757.00
RC207878L4 Lenti ORF clone of Human poly(rC) binding protein 1 (PCBP1), mGFP tagged 10 ug
$757.00
RG207878 PCBP1 (tGFP-tagged) - Human poly(rC) binding protein 1 (PCBP1) 10 ug
$489.00 MSRP $657.00 MSRP $657.00
SC116302 PCBP1 (untagged)-Human poly(rC) binding protein 1 (PCBP1) 10 ug
$457.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.