Granzyme K (GZMK) (NM_002104) Human Tagged ORF Clone

SKU
RC207798
GZMK (Myc-DDK-tagged)-Human granzyme K (granzyme 3, tryptase II) (GZMK)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol Granzyme K
Synonyms TRYP2
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC207798 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGACTAAGTTTTCTTCCTTTTCTCTGTTTTTCCTAATAGTTGGGGCTTATATGACTCATGTGTGTTTCA
ATATGGAAATTATTGGAGGGAAAGAAGTGTCACCTCATTCCAGGCCATTTATGGCCTCCATCCAGTATGG
CGGACATCACGTTTGTGGAGGTGTTCTGATTGATCCACAGTGGGTGCTGACAGCAGCCCACTGCCAATAT
CGGTTTACCAAAGGCCAGTCTCCCACTGTGGTTTTAGGCGCACACTCTCTCTCAAAGAATGAGGCCTCCA
AACAAACACTGGAGATCAAAAAATTTATACCATTCTCAAGAGTTACATCAGATCCTCAATCAAATGATAT
CATGCTGGTTAAGCTTCAAACAGCCGCAAAACTCAATAAACATGTCAAGATGCTCCACATAAGATCCAAA
ACCTCTCTTAGATCTGGAACCAAATGCAAGGTTACTGGCTGGGGAGCCACCGATCCAGATTCATTAAGAC
CTTCTGACACCCTGCGAGAAGTCACTGTTACTGTCCTAAGTCGAAAACTTTGCAACAGCCAAAGTTACTA
CAACGGCGACCCTTTTATCACCAAAGACATGGTCTGTGCAGGAGATGCCAAAGGCCAGAAGGATTCCTGT
AAGGGTGACTCAGGGGGCCCCTTGATCTGTAAAGGTGTCTTCCACGCTATAGTCTCTGGAGGTCATGAAT
GTGGTGTTGCCACAAAGCCTGGAATCTACACCCTGTTAACCAAGAAATACCAGACTTGGATCAAAAGCAA
CCTTGTCCCGCCTCATACAAAT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC207798 protein sequence
Red=Cloning site Green=Tags(s)

MTKFSSFSLFFLIVGAYMTHVCFNMEIIGGKEVSPHSRPFMASIQYGGHHVCGGVLIDPQWVLTAAHCQY
RFTKGQSPTVVLGAHSLSKNEASKQTLEIKKFIPFSRVTSDPQSNDIMLVKLQTAAKLNKHVKMLHIRSK
TSLRSGTKCKVTGWGATDPDSLRPSDTLREVTVTVLSRKLCNSQSYYNGDPFITKDMVCAGDAKGQKDSC
KGDSGGPLICKGVFHAIVSGGHECGVATKPGIYTLLTKKYQTWIKSNLVPPHTN

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_002104
ORF Size 792 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_002104.3
RefSeq Size 1074 bp
RefSeq ORF 795 bp
Locus ID 3003
UniProt ID P49863
Cytogenetics 5q11.2
Domains Tryp_SPc
Protein Families Druggable Genome, Protease, Secreted Protein, Transmembrane
MW 28.9 kDa
Summary This gene product is a member of a group of related serine proteases from the cytoplasmic granules of cytotoxic lymphocytes. Cytolytic T lymphocytes (CTL) and natural killer (NK) cells share the remarkable ability to recognize, bind, and lyse specific target cells. They are thought to protect their host by lysing cells bearing on their surface 'nonself' antigens, usually peptides or proteins resulting from infection by intracellular pathogens. The protein described here lacks consensus sequences for N-glycosylation present in other granzymes. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:Granzyme K (GZMK) (NM_002104) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC207798L1 Lenti ORF clone of Human granzyme K (granzyme 3; tryptase II) (GZMK), Myc-DDK-tagged 10 ug
$600.00
RC207798L2 Lenti ORF clone of Human granzyme K (granzyme 3; tryptase II) (GZMK), mGFP tagged 10 ug
$600.00
RC207798L3 Lenti ORF clone of Human granzyme K (granzyme 3; tryptase II) (GZMK), Myc-DDK-tagged 10 ug
$600.00
RC207798L4 Lenti ORF clone of Human granzyme K (granzyme 3; tryptase II) (GZMK), mGFP tagged 10 ug
$600.00
RG207798 GZMK (tGFP-tagged) - Human granzyme K (granzyme 3; tryptase II) (GZMK) 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC118834 GZMK (untagged)-Human granzyme K (granzyme 3, tryptase II) (GZMK) 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.