FFAR3 (NM_005304) Human Tagged ORF Clone
SKU
RC207772
FFAR3 (Myc-DDK-tagged)-Human free fatty acid receptor 3 (FFAR3)
-
TrueORF Gold
Protein expression verified by Western blot, fully sequenced and in stock
Click here to learn more.
Product Data | |
Type | Human Tagged ORF Clone |
---|---|
Target Symbol | FFAR3 |
Synonyms | FFA3R; GPR41; GPR42 |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
ORF Nucleotide Sequence
>RC207772 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGGATACAGGCCCCGACCAGTCCTACTTCTCCGGCAATCACTGGTTCGTCTTCTCGGTGTACCTTCTCA CTTTCCTGGTGGGGCTCCCCCTCAACCTGCTGGCCCTGGTGGTCTTCGTGGGCAAGCTGCAGCGCCGCCC GGTGGCCGTGGACGTGCTCCTGCTCAACCTGACCGCCTCGGACCTGCTCCTGCTGCTGTTCCTGCCTTTC CGCATGGTGGAGGCAGCCAATGGCATGCACTGGCCCCTGCCCTTCATCCTCTGCCCACTCTCTGGATTCA TCTTCTTCACCACCATCTATCTCACCGCCCTCTTCCTGGCAGCTGTGAGCATTGAACGCTTCCTGAGTGT GGCCCACCCACTGTGGTACAAGACCCGGCCGAGGCTGGGGCAGGCAGGTCTGGTGAGTGTGGCCTGCTGG CTGTTGGCCTCTGCTCACTGCAGCGTGGTCTACGTCATAGAATTCTCAGGGGACATCTCCCACAGCCAGG GCACCAATGGGACCTGCTACCTGGAGTTCCGGAAGGACCAGCTAGCCATCCTCCTGCCCGTGCGGCTGGA GATGGCTGTGGTCCTCTTTGTGGTCCCGCTGATCATCACCAGCTACTGCTACAGCCGCCTGGTGTGGATC CTCGGCAGAGGGGGCAGCCACCGCCGGCAGAGGAGGGTGGCGGGGCTGTTGGCGGCCACGCTGCTCAACT TCCTTGTCTGCTTTGGGCCCTACAACGTGTCCCATGTCGTGGGCTATATCTGCGGTGAAAGCCCGGCGTG GAGGATCTACGTGACGCTTCTCAGCACCCTGAACTCCTGTGTCGACCCCTTTGTCTACTACTTCTCCTCC TCCGGGTTCCAAGCCGACTTTCATGAGCTGCTGAGGAGGTTGTGTGGGCTCTGGGGCCAGTGGCAGCAGG AGAGCAGCATGGAGCTGAAGGAGCAGAAGGGAGGGGAGGAGCAGAGAGCGGACCGACCAGCTGAAAGAAA GACCAGTGAACACTCACAGGGCTGTGGAACTGGTGGCCAGGTGGCCTGTGCTGAAAGC ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>RC207772 protein sequence
Red=Cloning site Green=Tags(s) MDTGPDQSYFSGNHWFVFSVYLLTFLVGLPLNLLALVVFVGKLQRRPVAVDVLLLNLTASDLLLLLFLPF RMVEAANGMHWPLPFILCPLSGFIFFTTIYLTALFLAAVSIERFLSVAHPLWYKTRPRLGQAGLVSVACW LLASAHCSVVYVIEFSGDISHSQGTNGTCYLEFRKDQLAILLPVRLEMAVVLFVVPLIITSYCYSRLVWI LGRGGSHRRQRRVAGLLAATLLNFLVCFGPYNVSHVVGYICGESPAWRIYVTLLSTLNSCVDPFVYYFSS SGFQADFHELLRRLCGLWGQWQQESSMELKEQKGGEEQRADRPAERKTSEHSQGCGTGGQVACAES myc-FLAG tag |
Chromatograms |
Chromatograms
![]() Sequencher program is needed, download here |
Restriction Sites |
SgfI-MluI Cloning Scheme for this gene
Plasmid Map
![]() |
ACCN | NM_005304 |
ORF Size | 1038 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution Method | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Note | Plasmids are not sterile. For experiments where strict sterility is required, filtration with 0.22um filter is required. |
Shipping | Ambient |
Reference Data | |
RefSeq | NM_005304.5 |
RefSeq Size | 1709 bp |
RefSeq ORF | 1041 bp |
Locus ID | 2865 |
UniProt ID | O14843 |
Cytogenetics | 19q13.12 |
Domains | 7tm_1 |
Protein Families | Druggable Genome, GPCR, Transmembrane |
MW | 38.6 kDa |
Summary | G protein-coupled receptor that is activated by a major product of dietary fiber digestion, the short chain fatty acids (SCFAs), and that plays a role in the regulation of whole-body energy homeostasis and in intestinal immunity. In omnivorous mammals, the short chain fatty acids acetate, propionate and butyrate are produced primarily by the gut microbiome that metabolizes dietary fibers. SCFAs serve as a source of energy but also act as signaling molecules. That G protein-coupled receptor is probably coupled to the pertussis toxin-sensitive, G(i/o)-alpha family of G proteins. Its activation results in the formation of inositol 1,4,5-trisphosphate, the mobilization of intracellular calcium, the phosphorylation of the MAPK3/ERK1 and MAPK1/ERK2 kinases and the inhibition of intracellular cAMP accumulation (PubMed:12711604). Activated by SCFAs and by beta-hydroxybutyrate, a ketone body produced by the liver upon starvation, it inhibits N-type calcium channels and modulates the activity of sympathetic neurons through a signaling cascade involving the beta and gamma subunits of its coupled G protein, phospholipase C and MAP kinases. Thereby, it may regulate energy expenditure through the control of the sympathetic nervous system that controls for instance heart rate. Upon activation by SCFAs accumulating in the intestine, it may also signal to the brain via neural circuits which in turn would regulate intestinal gluconeogenesis. May also control the production of hormones involved in whole-body energy homeostasis. May for instance, regulate blood pressure through renin secretion. May also regulate secretion of the PYY peptide by enteroendocrine cells and control gut motility, intestinal transit rate, and the harvesting of energy from SCFAs produced by gut microbiota. May also indirectly regulate the production of LEP/Leptin, a hormone acting on the CNS to inhibit food intake, in response to the presence of short-chain fatty acids in the intestine. Finally, may also play a role in glucose homeostasis. Besides its role in energy homeostasis, may play a role in intestinal immunity. May mediate the activation of the inflammatory and immune response by SCFAs in the gut, regulating the rapid production of chemokines and cytokines by intestinal epithelial cells. Among SCFAs, the fatty acids containing less than 6 carbons, the most potent activators are probably propionate, butyrate and pentanoate while acetate is a poor activator (PubMed:12496283, PubMed:12711604).[UniProtKB/Swiss-Prot Function] |
Write Your Own Review
Product Manuals |
FAQs |
SDS |
SKU | Description | Size | Price | |
---|---|---|---|---|
RC207772L1 | Lenti ORF clone of Human free fatty acid receptor 3 (FFAR3), Myc-DDK-tagged | 10 ug |
$757.00
|
|
RC207772L2 | Lenti ORF clone of Human free fatty acid receptor 3 (FFAR3), mGFP tagged | 10 ug |
$757.00
|
|
RC207772L3 | Lenti ORF clone of Human free fatty acid receptor 3 (FFAR3), Myc-DDK-tagged | 10 ug |
$757.00
|
|
RC207772L4 | Lenti ORF clone of Human free fatty acid receptor 3 (FFAR3), mGFP tagged | 10 ug |
$757.00
|
|
RG207772 | FFAR3 (tGFP-tagged) - Human free fatty acid receptor 3 (FFAR3) | 10 ug |
$489.00
MSRP
$657.00
MSRP
$657.00
|
|
SC116811 | FFAR3 (untagged)-Human free fatty acid receptor 3 (FFAR3) | 10 ug |
$457.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.