CysLT1(CYSLTR1) (NM_006639) Human Tagged ORF Clone

CAT#: RC207763

CYSLTR1 (Myc-DDK-tagged)-Human cysteinyl leukotriene receptor 1 (CYSLTR1)

Change vector?

USD 577


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name CysLT1(CYSLTR1) (NM_006639) Human Tagged ORF Clone
Symbol CYSLTR1
Synonyms CYSLT1; CYSLT1R; CYSLTR; HMTMF81
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RC207763 representing NM_006639
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGATGAAACAGGAAATCTGACAGTATCTTCTGCCACATGCCATGACACTATTGATGACTTCCGCAATC
AAGTGTATTCCACCTTGTACTCTATGATCTCTGTTGTAGGCTTCTTTGGCAATGGCTTTGTGCTCTATGT
CCTCATAAAAACCTATCACAAGAAGTCAGCCTTCCAAGTATACATGATTAATTTAGCAGTAGCAGATCTA
CTTTGTGTGTGCACACTGCCTCTCCGTGTGGTCTATTATGTTCACAAAGGCATTTGGCTCTTTGGTGACT
TCTTGTGCCGCCTCAGCACCTATGCTTTGTATGTCAACCTCTATTGTAGCATCTTCTTTATGACAGCCAT
GAGCTTTTTCCGGTGCATTGCAATTGTTTTTCCAGTCCAGAACATTAATTTGGTTACACAGAAAAAAGCC
AGGTTTGTGTGTGTAGGTATTTGGATTTTTGTGATTTTGACCAGTTCTCCATTTCTAATGGCCAAACCAC
AAAAAGATGAGAAAAATAATACCAAGTGCTTTGAGCCCCCACAAGACAATCAAACTAAAAATCATGTTTT
GGTCTTGCATTATGTGTCATTGTTTGTTGGCTTTATCATCCCTTTTGTTATTATAATTGTCTGTTACACA
ATGATCATTTTGACCTTACTAAAAAAATCAATGAAAAAAAATCTGTCAAGTCATAAAAAGGCTATAGGAA
TGATCATGGTCGTGACCGCTGCCTTTTTAGTCAGTTTCATGCCATATCATATTCAACGTACCATTCACCT
TCATTTTTTACACAATGAAACTAAACCCTGTGATTCTGTCCTTAGAATGCAGAAGTCCGTGGTCATAACC
TTGTCTCTGGCTGCATCCAATTGTTGCTTTGACCCTCTCCTATATTTCTTTTCTGGGGGTAACTTTAGGA
AAAGGCTGTCTACATTCAGAAAGCATTCTTTGTCCAGCGTGACTTATGTACCCAGAAAGAAGGCCTCTTT
GCCAGAAAAAGGAGAAGAAATATGTAAAGTA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC207763 representing NM_006639
Red=Cloning site Green=Tags(s)

MDETGNLTVSSATCHDTIDDFRNQVYSTLYSMISVVGFFGNGFVLYVLIKTYHKKSAFQVYMINLAVADL
LCVCTLPLRVVYYVHKGIWLFGDFLCRLSTYALYVNLYCSIFFMTAMSFFRCIAIVFPVQNINLVTQKKA
RFVCVGIWIFVILTSSPFLMAKPQKDEKNNTKCFEPPQDNQTKNHVLVLHYVSLFVGFIIPFVIIIVCYT
MIILTLLKKSMKKNLSSHKKAIGMIMVVTAAFLVSFMPYHIQRTIHLHFLHNETKPCDSVLRMQKSVVIT
LSLAASNCCFDPLLYFFSGGNFRKRLSTFRKHSLSSVTYVPRKKASLPEKGEEICKV

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_006639
ORF Size 1011 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_006639.1, NM_006639.2, NM_006639.3, NP_006630
RefSeq Size 1537
RefSeq ORF 1014
Locus ID 10800
Cytogenetics Xq21.1
Domains 7tm_1
Protein Families GPCR, Transmembrane, Druggable Genome
Protein Pathways Calcium signaling pathway, Neuroactive ligand-receptor interaction
MW 38.4 kDa
Gene Summary Receptor for cysteinyl leukotrienes mediating bronchoconstriction of individuals with and without asthma. Stimulation by LTD4 results in the contraction and proliferation of smooth muscle, edema, eosinophil migration and damage to the mucus layer in the lung. This response is mediated via a G-protein that activates a phosphatidylinositol-calcium second messenger system. The rank order of affinities for the leukotrienes is LTD4 >> LTE4 = LTC4 >> LTB4. [UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations