CST6 (NM_001323) Human Tagged ORF Clone

SKU
RC207689
CST6 (Myc-DDK-tagged)-Human cystatin E/M (CST6)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$150.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol CST6
Synonyms ECTD15
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC207689 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGCGTTCGAACCTCCCGCTGGCGCTGGGCCTGGCCCTGGTCGCATTCTGCCTCCTGGCGCTGCCAC
GCGACGCCCGGGCCCGGCCGCAGGAGCGCATGGTCGGAGAACTCCGGGACCTGTCGCCCGACGACCCGCA
GGTGCAGAAGGCGGCGCAGGCGGCCGTGGCCAGCTACAACATGGGCAGCAACAGCATCTACTACTTCCGA
GACACGCACATCATCAAGGCGCAGAGCCAGCTGGTGGCCGGCATCAAGTACTTCCTGACGATGGAGATGG
GGAGCACAGACTGCCGCAAGACCAGGGTCACTGGAGACCACGTCGACCTCACCACTTGCCCCCTGGCAGC
AGGGGCGCAGCAGGAGAAGCTGCGCTGTGACTTTGAGGTCCTTGTGGTTCCCTGGCAGAACTCCTCTCAG
CTCCTAAAGCACAACTGTGTGCAGATG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC207689 protein sequence
Red=Cloning site Green=Tags(s)

MARSNLPLALGLALVAFCLLALPRDARARPQERMVGELRDLSPDDPQVQKAAQAAVASYNMGSNSIYYFR
DTHIIKAQSQLVAGIKYFLTMEMGSTDCRKTRVTGDHVDLTTCPLAAGAQQEKLRCDFEVLVVPWQNSSQ
LLKHNCVQM

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_001323
ORF Size 447 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_001323.4
RefSeq Size 618 bp
RefSeq ORF 450 bp
Locus ID 1474
UniProt ID Q15828
Cytogenetics 11q13.1
Protein Families Secreted Protein
MW 16.5 kDa
Summary The cystatin superfamily encompasses proteins that contain multiple cystatin-like sequences. Some of the members are active cysteine protease inhibitors, while others have lost or perhaps never acquired this inhibitory activity. There are three inhibitory families in the superfamily, including the type 1 cystatins (stefins), type 2 cystatins and the kininogens. The type 2 cystatin proteins are a class of cysteine proteinase inhibitors found in a variety of human fluids and secretions, where they appear to provide protective functions. This gene encodes a cystatin from the type 2 family, which is down-regulated in metastatic breast tumor cells as compared to primary tumor cells. Loss of expression is likely associated with the progression of a primary tumor to a metastatic phenotype. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:CST6 (NM_001323) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC207689L1 Lenti ORF clone of Human cystatin E/M (CST6), Myc-DDK-tagged 10 ug
$450.00
RC207689L2 Lenti ORF clone of Human cystatin E/M (CST6), mGFP tagged 10 ug
$450.00
RC207689L3 Lenti ORF clone of Human cystatin E/M (CST6), Myc-DDK-tagged 10 ug
$450.00
RC207689L4 Lenti ORF clone of Human cystatin E/M (CST6), mGFP tagged 10 ug
$450.00
RG207689 CST6 (tGFP-tagged) - Human cystatin E/M (CST6) 10 ug
$489.00
SC126202 CST6 (untagged)-Human cystatin E/M (CST6) 10 ug
$150.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.