MARCHF2 (NM_016496) Human Tagged ORF Clone

SKU
RC207517
MARCH2 (Myc-DDK-tagged)-Human membrane-associated ring finger (C3HC4) 2 (MARCH2), transcript variant 1
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol MARCHF2
Synonyms HSPC240; MARCH-II; MARCH2; RNF172
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC207517 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGACGACGGGTGACTGCTGCCACCTCCCCGGCTCCCTGTGTGACTGCTCCGGCAGCCCTGCCTTCTCCA
AGGTCGTGGAGGCTACGGGCCTCGGACCGCCCCAGTATGTGGCACAGGTGACTTCAAGGGATGGCCGGCT
CCTCTCCACCGTCATCCGTACCTTGGACACACCGAGTGATGGTCCTTTCTGCCGGATCTGCCATGAGGGA
GCGAACGGGGAGTGCTTGCTGTCCCCGTGTGGCTGCACCGGCACGCTGGGTGCCGTGCATAAGAGCTGTC
TGGAGAAGTGGCTTTCCTCATCTAACACCAGCTACTGCGAGCTGTGCCACACGGAGTTTGCAGTGGAGAA
ACGGCCTCGACCCCTCACAGAGTGGCTGAAGGACCCGGGGCCGCGGACGGAGAAGCGGACACTGTGCTGC
GACATGGTGTGTTTCCTGTTCATCACACCGCTGGCCGCCATCTCAGGCTGGTTGTGCCTGCGCGGGGCCC
AGGACCACCTCCGGCTCCACAGCCAGCTGGAGGCCGTGGGTCTCATTGCCCTCACCATCGCCCTCTTCAC
CATCTATGTCCTCTGGACGCTGGTCTCCTTCCGCTACCACTGCCAGCTGTACTCCGAGTGGAGAAAGACC
AACCAGAAAGTTCGCCTGAAGATCCGGGAGGCGGACAGCCCCGAGGGCCCCCAGCATTCTCCACTGGCAG
CTGGACTCCTGAAGAAGGTGGCAGAGGAGACACCAGTA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC207517 protein sequence
Red=Cloning site Green=Tags(s)

MTTGDCCHLPGSLCDCSGSPAFSKVVEATGLGPPQYVAQVTSRDGRLLSTVIRTLDTPSDGPFCRICHEG
ANGECLLSPCGCTGTLGAVHKSCLEKWLSSSNTSYCELCHTEFAVEKRPRPLTEWLKDPGPRTEKRTLCC
DMVCFLFITPLAAISGWLCLRGAQDHLRLHSQLEAVGLIALTIALFTIYVLWTLVSFRYHCQLYSEWRKT
NQKVRLKIREADSPEGPQHSPLAAGLLKKVAEETPV

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_016496
ORF Size 738 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_016496.3, NP_057580.2
RefSeq Size 1705 bp
RefSeq ORF 741 bp
Locus ID 51257
UniProt ID Q9P0N8
Cytogenetics 19p13.2
Domains RING
Protein Families Druggable Genome, Transmembrane
MW 27 kDa
Summary MARCH2 is a member of the MARCH family of membrane-bound E3 ubiquitin ligases (EC 6.3.2.19). MARCH enzymes add ubiquitin (see MIM 191339) to target lysines in substrate proteins, thereby signaling their vesicular transport between membrane compartments. MARCH2 reduces surface accumulation of several glycoproteins and appears to regulate early endosome-to-trans-Golgi network (TGN) trafficking (Bartee et al., 2004 [PubMed 14722266]; Nakamura et al., 2005 [PubMed 15689499]).[supplied by OMIM, Mar 2010]
Write Your Own Review
You're reviewing:MARCHF2 (NM_016496) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC207517L1 Lenti ORF clone of Human membrane-associated ring finger (C3HC4) 2 (MARCH2), transcript variant 1, Myc-DDK-tagged 10 ug
$600.00
RC207517L2 Lenti ORF clone of Human membrane-associated ring finger (C3HC4) 2 (MARCH2), transcript variant 1, mGFP tagged 10 ug
$600.00
RC207517L3 Lenti ORF clone of Human membrane-associated ring finger (C3HC4) 2 (MARCH2), transcript variant 1, Myc-DDK-tagged 10 ug
$600.00
RC207517L4 Lenti ORF clone of Human membrane-associated ring finger (C3HC4) 2 (MARCH2), transcript variant 1, mGFP tagged 10 ug
$600.00
RG207517 41335 (tGFP-tagged) - Human membrane-associated ring finger (C3HC4) 2 (MARCH2), transcript variant 1 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC114251 41335 (untagged)-Human membrane-associated ring finger (C3HC4) 2 (MARCH2), transcript variant 1 10 ug
$300.00
SC323978 41335 (untagged)-Human membrane-associated ring finger (C3HC4) 2 (MARCH2), transcript variant 1 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.